Цсп вес: технические характеристики, применение, размеры и цены

Содержание

ЦСП

(863) 236-77-77

(863) 236-70-45

(863) 244-89-44

(900) 136-60-30

[email protected]

Внимание

 Мы готовы выполнить Ваш заказ по комплексному снабжению строительного объекта или на поставку отдельных стройматериалов, не входящих в наш перечень.

Новости

10.08.2020

Кварцевый песок для птицеводства, оптом и в розницу

07.02.2019

Агроперлит

11.10.2018

Распродажа блоков из отсева щебня

24.09.2018

Акция на белый цемент ADANA

06.

09.2018

Акция на оптовые поставки керамзита


ЦЕМЕНТНО-СТРУЖЕЧНАЯ ПЛИТА

Номенклатура ЦСП
Размеры, мм Вес 1
листа, кг
Площадь
листа, м2
Объём
листа, м3
Кол-во
листов в 1 м3
Вес
1 м3, кг
длина ширина толщина
2700
1250
8 36,45 3,375 0,0270 37,04 1300-1400
10 45,56 0,0338 29,63
12 54,68 0,0405 24,69
16 72,90 0,0540 18,52
20 91,13 0,0675 14,81
24 109,35 0,0810 12,53
36 164,03 0,1215 8,23
3200 1250 8 43,20 4,000 0,0320 31,25 1300-1400
10 54,00 0,0400 25,00
12 64,80 0,0480 20,83
16 86,40 0,0640 15,63
20 108,00 0,0800 12,50
24 129,60 0,0960 10,42
36 194,40 0,1440 6,94

Физико-механические свойства ЦСП
Наименование показателя, ед. измерения Величина показателя
1. Плотность, кг/м3 1250 - 1400
2. Влажность, % 9 ± 3
3. Разбухание по толщине за 24 ч, %, не более 2
4. Водопоглощение за 24 ч, %, не более 16
5. Прочность при изгибе, МПа, не менее 
для толщины 10, 12, 16 мм
для толщины 24 мм
для толщины 36 мм
6. Прочность при растяжении (перпендикулярно пласти плиты), МПа, не менее 0,4
7. Модуль упругости при изгибе, МПа, не менее 3500
8. Ударная вязкость, ДЖ/м2 9
9. Группа горючести Г1
10. Морозостойкость (снижение прочности при изгибе после 50 циклов), %, не более 10
11. Шероховатость Rz по ГОСТ 7016-82, мм, не более для плит: 
нешлифованных
шлифованных

 

 

12. Предельные отклонения по толщине, мм, не более для плит: 
шлифованных  
нешлифованных толщиной: 10 мм
  12 ÷ 16 мм
  24 мм
  36 мм

 

 

 ± 0,3
 ± 0,6
 ± 0,8
 ± 1,0
 ± 1,4
13. Предельные отклонения по длине и ширине плит, мм: ± 3
14. Коэффициент теплопроводности, Вт/(м·К): 0,26
15. Коэффициент линейного расширения, мм/(п.м.·°C) или град-1·10-6: 0,0235 или 23,5
16. Коэффициент паропроницаемости, мг/(м·ч·Па): 0,03

Справочные показатели физико-механических свойств ЦСП
Наименование показателя, ед. измерения Значение для плит ЦСП-1 ГОСТ
1 Модуль упругости при изгибе, МПа, не менее 3500 ГОСТ 10635-88
2 Твёрдость, МПа 46-65 ГОСТ 11843-76
3 Ударная вязкость, Дж/м, не менее 1800 ГОСТ 11843-76
4 Удельное сопротивление выдёргиванию шурупов из пластин, Н/м 4-7 ГОСТ 10637-78
5 Удельная теплоёмкость, кДж/(кг·K) 1,15 -
6 Класс биостойкости 4 ГОСТ 17612-89
8 Снижение прочности при изгибе (после 20 циклов температурно-влажностных воздействий), %, не более 30 -
9 Разбухание по толщине (после 20 циклов температурно-влажностных воздействий), %, не более 5 -
10 Горючесть слабогор.  Г1 ГОСТ 30244-94
11 Морозостойкость (снижение прочности при изгибе после 50 циклов), %, не более 10 ГОСТ 8747-88

Таблица нагрузки на ЦСП «cосредоточенная нагрузка»
Пролёт
мм
Нагрузка, кН
Толщина
8 мм
Толщина
10 мм
Толщина
12 мм
Толщина
16 мм
Толщина
20 мм
Толщина
24 мм
Толщина
36 мм
200 0,213 0,345 0,480 0,813 1,414 2,007 4,802
250 0,171 0,267 0,387 0,623 1,031 1,572 3,280
300 0,142 0,212 0,307 0,508 0,803 1,167 2,687
350 0,110 0,168 0,267 0,423 0,688 1,030 2,288
400 0,096 0,153 0,248 0,377 0,622 0,945 2,042
450 0,082 0,128 0,195 0,347 0,553 0,760 1,147
500 0,056 0,095 0,185 0,345 0,541 0,667 1,572


Теплотехнические свойства

ЦСП, благодаря органическому соединению древесины и цемента, представляют собой однородный монолитный материал без воздушных вкраплений, что обеспечивает высокую теплопроводность. Поэтому наибольшее применение ЦСП находят в конструкциях, где требуется сочетание высокой прочности и низкого температурного сопротивления материала. Теплотехнические свойства ЦСП оцениваются с помощью коэффиуиента теплопроводности, который является важнейшим теплотехническим показателем строительных материалов.

Зависимость коэффициента теплопроводности от толщины плиты

Толщина плит, мм Теплопроводность, Вт/м·°C Температурное сопротивление, м2·°C/Вт
8 0,26 0,031
10 0,035
12 0,046
16 0,062
20 0,077
24 0,092
36 0,138

Звукоизоляция

Индекс изоляции воздушного шума

ЦСП 10 мм RW=30 дБ
ЦСП 12 мм RW=31 дБ

Индекс изоляции ударного шума

Цементно-стружечные плиты толщиной 20 и 24 мм, уложенные непосредственно на железобенонное несущее перекрытие измерительной камеры НИИСФ РААСН, обеспечивают улучшение изоляции ударного шума на 16-17 дБ соответственно.

При укладывании цементно-стружечных плит толщиной 20 и 24 мм не непосредственно на железобетонную плиту перекрытия, а на промежуточный слой упруго мягкого материала происходит доролнительно улучшение изоляции ударного шума, составляющее 9-10 дБ.

Удельное сопротивление выдёргиванию шурупов

Наименование
шурупа,
DxL, мм
Диаметр отверстия
под шуруп, мм
Среднее удельное
сопротивление из
5 испытаний, Н/мм
Разброс удельного
сопротивления,
Н/мм
1 5,5 х 30 3,0 122 118 ÷ 137
2 5,0 х 30 3,0 85 68 ÷ 103
3 4,5 х 30 3,0 93 80 ÷ 108
4 4,0 х 30
(L резьбы 20 мм)
2,5 110 88 ÷ 147
5 4,0 х 30
(L резьбы полная)
2,5 114 103 ÷ 124
6 3,5 х 30 2,5 104 87 ÷ 116
      ср. 105  

харктеристики, приминение, размеры, вес, инструкция монтажа и отделки плиты ЦСП пошагово, рекомендации от специалистов

Современное строительство широко применяет цементно-стружечные плиты (ЦСП) для наружной и внутренней отделки. Разбираемся, что представляет собой  материал и как его используют.

Современное строительство невозможно без применения современных строительных и отделочных материалов. В огромном разнообразии композитов, применяемых для отделки, особое место принадлежит плитам из цемента и древесной стружки. Этот материал на базе древесины по многим параметрам выигрывает у остальных стружечных композитов: ОСП, ДСП и другие. Разберемся, в чем специфика ЦСП и для решения каких задач его допустимо применять.

Что такое плита ЦСП

По своему происхождению ЦСП принадлежит к композитам. Для ее приготовления применяется портландцемент, который смешивается с деревянной щепой с особыми характеристиками. Ее форма в виде длинных тонких игл (при длине в 1-3 см толщина щепы составляет всего 0,2-0,3 мм) обеспечивает отличные эксплуатационные свойства.

Помимо цемента и щепы в смесь для формования плит ЦСП входят:

  • Жидкое стекло.
  • Сульфат алюминия.
  • Мазут или технические масла в небольших количествах.
  • Вода (порядка 8 частей из 100).

Добавки придают плите стойкость к развитию плесневых грибков и бактерий. Кроме того, они снижают способность цемента разрушать древесину, повышают пластичность смеси, придают ей стойкость к пламени.

[important]Высококачественные ЦСП представляют собой «сэндвич» из 3 и более слоев. Внешние пласты сделаны из смеси на основе мелкой щепы. Они более гладкие и простые для отделки. Глубинные слои имеют в основе более грубые, крупные щепки, что придает им дополнительную прочность.[/important]

Покрытие плит может шлифоваться для облегчения чистовых работ по отделке. Также существуют разновидности, на внешний слой которых нанесен рельеф, имитирующий кирпичную кладку или фактуру натурального камня.

Помимо декоративных свойств, ЦСП имеют ряд параметров, которые определяют их применимость в той или иной сфере. Рассмотрим их более подробно. Для того чтобы узнать как правильно произвести отделку стен пластиковыми панелями в этой статье.

Плотность

Одна из наиболее важных характеристик. От плотности зависит способность плиты противостоять эксплуатационным нагрузкам, а также ее масса. Чтобы охарактеризовать плотность, обычно указывают, сколько весит 1 куб. м материала. У ЦСП этот параметр колеблется от 1100 до 1400 кг.

Масса

Масса ЦСП напрямую связана с ее плотностью. Она довольно велика, и превышает аналогичные характеристики других композитов на базе древесной стружки в 2 раза и более. Плита с длиной 2,7 м и шириной в 1,25 может весить от 36,5 кг и до 164 кг, в зависимости от толщины. Такая масса усложняет монтаж плит и другие операции с ними (транспортировку, подъем на высокие этажи и т.д). Однако стоит подчеркнуть, что среди всех материалов на основе портландцемента, ЦСП – один из самых легких.

[warning]На вес цементно-стружечной плиты существенно влияет ее влажность. Стандарт допускает колебания этого параметра в пределах 3% от базового (9%), так что одна и та же плита в разных условиях может весить по-разному.[/warning]

Прочность

Плита отлично противостоит сжатию и продольным деформациям. Ее прочностные характеристики вполне позволяют использовать листы ЦСП для упрочнения стен. Однако способность противостоять изгибу и особенно растяжению у этого материала гораздо меньше.

Размеры

ЦСП – сравнительно новый материал. Поэтому число размеров, в которых он выпускается, не слишком велико. Стандартом ширины плит является 1 м 25 см. Длина варьирует в диапазоне от 2 м 70 см до 3 м 20 см. Толщина более разнообразна: существует 7 размеров, из которых наиболее широко используются 1 см, 1,6 см и 2 см. Максимальное же значение толщины достигает 3 см 6 мм.

Где применяется цементно-стружечная плита

Плиты на основе цемента и стружки нашли широкое применение в «сухом» строительстве. Наиболее широко они используются для возведения зданий по каркасной схеме. Этому способствует способность плиты существенно повышать прочность каркаса (при правильном монтаже).

Другая причина высокой популярности ЦСП в высоких показателях безопасности материала. Ни в процессе нормальной эксплуатации, ни при пожаре композит не выделяет вредных летучих веществ. Он не поддерживает горение и не позволяет пламени распространяться по своей поверхности.

Широкое применение материал нашел в малоэтажном (до 3-х включительно) строительстве. Он отлично подходит не только для строительства коттеджей и частных домов, но и для зданий общего пользования: офисов, развлекательных центров, гостиниц, промышленных цехов. Высокая безопасность и экологичность цементно-стружечного композита позволяет использовать его на строительстве детских учреждений, школ, больниц, санаториев.

Еще одна сфера применения цементно-стружечных плит – возведение уличных построек в приусадебном хозяйстве. Хозблоки, бытовки, сараи, погреба, уличные туалеты, выстроенные из ЦСП, служат долгие годы благодаря высокой устойчивости материала к атмосферной влаге, колебаниям температуры, росту бактерий и плесневых грибков.

[warning]Низкая стойкость материала к деформации на изгиб несколько ограничивает его сферу применения. ЦСП либо укладывают на пол (на прочное основание), либо навешивают на каркас в строго отвесном положении. Класть этот материал под углом или использовать для оформления арочных конструкций нельзя![/warning]

Во внутренней отделке плиты на основе цемента и древесной стружки также нашли широкое применение. Из них делают внутренние перегородки, черновые полы, подоконники. Также с помощью ЦСП выравнивают поверхности стен и потолка.

Особенности монтажа

Закреплять плиту на каркасе допускается при помощи саморезов или гвоздей. Подбор крепежа осуществляют так:

  • Для саморезов берут толщину от 2,5 мм. Чем более тяжелые листы, тем толще подбираются саморезы. Длина определяется толщиной «пирога», которым обшивают каркас. Перед тем, как вкручивать крепеж, дрелью сверлят отверстия под саморезы.
  • Для гвоздей подбор длины и толщины делается по тому же принципу. В дерево должно входить не менее 10 диаметров гвоздя, чтобы обеспечить надежную фиксацию.

[warning]Плита ЦСП весит много, поэтому для надежной фиксации ее на каркасе крайне важно не экономить на крепеже. В таблице показано рекомендованное количество крепежных элементов для различных типоразмеров, а также максимально допустимое расстояние между ними.[/warning]

Лист крепится по периметру, со строгим соблюдением отвесности размещения плиты и частоты установки крепежа. После того, как лист закреплен по периметру, необходимо притянуть его еще и по линии, которая идет посередине высоты плиты (горизонтально). На этой линии допустимо вкручивать саморезы вдвое реже, чем по периметру.

Укладка ЦСП на пол

Если плита применяется для создания чернового пола, технология предполагает размещение системы лаг. На лаги используется брус (его размеры: ширина 5 см, толщина – 8 см). Лаги кладут на основание, предварительно уложив слой звуко- и гидроизоляции. Шаг между лагами – порядка 0,6 м.

Между лагами кладется слой утеплителя. Толщина слоя подбирается так, чтобы после укладки и укрытия гидроизоляционной мембраной слой оказался на пару сантиметров глубже лаг. Такой зазор необходим для организации вентиляции.

На лаги кладут плиту ЦСП (обычно с толщиной в 2 см). Плиту крепят к лагам саморезами, утапливая потайные головки вровень с поверхностью пола. Швы тщательно заделывают с помощью герметика. Поверх плиты уже можно уложить чистовой пол.

Монтаж плиты ЦСП своими руками. Пошаговая инструкция

Перед началом монтажа следует составить проект. Он позволит понять сколько листов потребуется укрепить, где у каждого листа будут находиться крепежные элементы, на какие куски придется резать купленную плиту. Перед работой требуется тщательно продумать, как будет удерживаться плита на своем месте до полной фиксации. Поскольку цементно-стружечный композит весьма тяжел, стоит продумать возможность применения подъемных механизмов.

[important] В работе с ЦСП, как никогда, важна каждая пара рук. Поэтому начинать работу одному категорически не рекомендуется. Лучше работать с хотя бы одним помощником.[/important]

Порядок действий таков:

  • Ориентируясь на составленный проект, нарезаем плиту на куски нужного размера. Режется цементно-стружечный композит теми же инструментами, что и обычная ДСП, но пилки нужны более твердые.
  • На каждом куске сверлим отверстия под саморезы.
  • Прикладываем кусок к каркасу, проверив отвесность с помощью уровня.
  • Вкручиваем саморезы по углам, затем по периметру и посередине.
  • Закрепляем куски один за другим, пока обшивка не будет выполнена. Дальше заделываем швы герметиком или закрываем специальной рейкой.

[warning]В здании ширина шва – не менее 0,4 см, снаружи – не менее 0,8. Иначе стыки начнут трескаться.[/warning]

Остается только покрасить плиту или оштукатурить для нанесения чистовой отделки.

Советы профессионалов

Любое дело лучше получается, если использовать практические наработки. Такой багаж ценных знаний об особенностях выбора и монтажа ЦСП можно приобретать на собственном опыте, но ошибки приведут к задержкам в строительстве и финансовым потерям. Поэтому мы предлагаем посмотреть несколько полезных видеофрагментов, чтобы ознакомиться с опытом профессиональных строителей:

Использование современных отделочных материалов позволяет выполнить строительные работы гораздо быстрее, не разводя лишней грязи и получая в итоге прекрасный результат. Как раз такие возможности предоставляет строителю использование ЦСП.

Однако перед началом работы стоит ознакомиться со всеми особенностями этого материала. Это поможет не ожидать от него невозможного и избежать досадных ошибок в монтаже. Надеемся, что советы, содержащиеся в этой статье, помогут вам в работе!

ЦСП: технические характеристики

Среди плитных и листовых материалов, используемых для отделки и сооружения перегородок и различных дизайнерских элементов, нельзя обойти стороной цементно-стружечную плиту или ЦСП. Конечно, по своей популярности она уступает гипсокартону, но, как показывает практика, и ей в современном мире находится место. Чаще всего плита ЦСП используется строителями в качестве опалубки. Она ровная, с хорошей прочностью, плюс – с ее помощью собрать опалубку гораздо быстрее, чем из досок.

Многие могут усомниться в том, что применение ЦСП целесообразно для сооружения опалубки. Ведь ее может заменить, к примеру, металл или фанера, к тому же бывшие в употреблении. Наверное, оно так и есть, но плита толщиною 24-26 мм выдерживает достаточно серьезные нагрузки. К тому же, если устанавливать несъемную опалубку с использованием цементно-стружечного материала, то, по сути, получится уже готовый отделанный фундамент или другой конструктивный элемент здания. И это во многих ситуация большой плюс.

К тому же необходимо учитывать и то, в каких условиях будет эксплуатироваться отделываемое помещение. К примеру, если это спортзал, то ни о каком гипсокартоне речь идти не может. Просто он ударов мяча не выдержит. А плиты ЦСП выдержат. Их можно использовать для обвязки и обшивки каркасных домов. Лучше этого материала для данного значения сегодня не найти. Плюсом является и возможность не только красить цементно-стружечный материал, но и использовать его, как финишную отделку. Благо производители сегодня предлагают огромный ассортимент с оформление под разные материалы, как показано на фото выше.

Технология производства ЦСП

Из самого названия становится понятным, что основными компонентами этого материала являются цемент (65%) и древесная стружка (24%). Все это смешивается с водой (8,5%), и в полученную смесь добавляются различные добавки, улучшающие технические характеристики плиты (2,5%).

В процесс производства ЦСП плиты используются два вида стружечного материала. Отличаются они по размерам: мелкая и средняя. Сама плита имеет трехслойную структуру, так вот во второй слой засыпается стружка средней величины, а в первый и третий мелкая. Сам производственный процесс проходит в следующей последовательности.

  • Производится смешивание стружки с гидратационными добавками.
  • В полученную смесь добавляется цемент марки М500.
  • Заливается вода.
  • Раствор тщательно перемешивается до получения однородной массы.
  • В форму заливается первый слой с мелкой стружкой.
  • Второй слой со средних размеров стружкой.
  • И третий слой.
  • Производится прессование.
  • После чего полуготовый материал подвергается нагреву до +90С в течение восьми часов.
  • Далее в течение 13-15 дней он сушится в естественных условиях.
  • После чего, в зависимости от партии, его или шлифуют, или просто складируют.

Технические характеристики

То, что это прочный материал, понятно, потому что в его состав входит цементный компонент. Но он и влагостойкий за счет использования гидратационных компонентов. Плюс, плиты ЦСП обладают великолепной несущей способность, что не скажешь о ГКЛ или фанере. Но многое будет зависеть от параметров плиты.

Что касается ширины, то она стандартная – 1,2 м. А вот толщина и длина – размеры, которые варьируются в достаточно большом диапазоне. Что касается длины, то производитель может ее нарезать под любой размер, если партия заказа будет большой. Но есть и стандартные величины: 2,7; 3,0; 3,2 и 3,6 м.

Что касается толщины, то и здесь достаточно приличный диапазон: от 8 до 40 мм. Соответственно и вес изделия будет расти с ростом толщины. К примеру, плита длиною 2,7 м и толщиною 8 мм весит 35 кг. При толщине 40 мм вес вырастит до 176 кг.

При длине ЦСП 3,2 м и толщине 8 мм, ее масса будет равна 41 кг. При той же длине и толщине 24 мм, вес составит 124 кг.

В конструкции плит ЦСП нет скругленных кромок и нет фасок. Кромки прямые и четко обрезанные, так что проблем со стыковой панелей и подгонкой быть не должно. Их не надо обрабатывать перед отделкой антисептическими составами, потому что в процессе изготовления антисептик добавляется в сырьевой раствор.

Остальные технические характеристики по ГОСТ:

  • Выдерживает большие минусовые температуры. При этом процесс размораживания может происходить до 50 раз. После чего прочность плит снижается всего лишь на 10%.
  • Погрешности по внешней плоскости составляет 0,8 мм.
  • Разность длин диагоналей может составлять 0,2%. Это практически не более 5 мм на длину 2,7 м.
  • Погрешность толщины (допускаемая) не более 0,8 мм. Это для нешлифованного материала, для шлифованного 0,3 мм.
  • Водопоглощение составляет 16%, при этом за сутки при высокой влажности плита не должна увеличиваться в размере более чем 2%.
  • Выдерживаемые нагрузки на растяжение – 0,4 МПа, на изгиб 9-12 МПа в зависимости от толщины изделия. Чем толще, тем меньше выдерживает нагрузки на изгиб.

Производители сегодня предлагают два вида цементно-стружечного материала, которые отличаются друг от друга качественными характеристиками. Это ЦСП-1 и ЦСП-2. Первый лучше.

Существует мнение, что плиты этого типа по многим позициям уступают гипсокартону. Не стоит сравнивать эти два материала, у них разное предназначение и разные сферы применения. Вышеописанные примеры это подтверждают. Конечно, у ЦСП есть свои недостатки, о которых поговорим.

  • По сравнению с гипсокартоном цементно-стружечные плиты стоят почти в два раза дороже. Но ГКЛ нелья использовать для внешней отделки, да и обшивать им каркасный дом лучше не стоит.
  • Вес каждой плиты может привести в ужас, особенно толщиною больше 16 мм. Работать с ними в одиночку не получиться. Под них придется сооружать прочный и надежный каркас. Да и фундамент придется усиливать, если их использовать для обшивки каркасного строения.
  • К тому же цементный компонент придает материалу повышенную прочность, так что обрабатывать его затруднительно. Поэтому подрезку надо проводить болгаркой или ручной циркулярной пилой, при этом использовать не простой режущий инструмент, а алмазный.
  • О каркасе уже говорилось, но необходимо добавить, что профили под гипсокартон здесь не подойдут, особенно, если речь идет о внешней отделке плитами ЦСП. Здесь необходим стандартный стальной профиль.
  • При резке плит выделяется большое количество пыли, так что производить эту операцию надо только на открытом воздухе.

Необходимо отметить, что на рынке недавно появилась плита толщиною 4 мм, что позволяет изменить подход к решению многих задач. К примеру, использовать в качестве элементов каркаса не стальные профили. Работать с таким материалом проще и в плане монтажа, и в плане обработки.

Как видите, у плит ЦСП серьезные технические характеристики. Особенно необходимо отметить их прочность, несравнимую ни с гипсокартоном, ни с фанерой. Да и эстетические качества материала не ниже, чем прочностные. Не зря же мастера рекомендуют ЦСП для установки подоконников или отделки каминов и вентиляционных коробов.

Цементно–стружечная плита (ЦСП) — применение, технические характеристики, толщина, вес

Листовые строительные материалы используются во многих видах строительных работ, которые принято называть «сухими». Один из таких материалов — плита ЦСП. Это прочный материал, который можно использовать при строительстве каркасных домов и хозпостроек, для внутренних и наружных отделочных работ. 

Блок: 1/7 | Кол-во символов: 313
Источник: https://stroychik.ru/strojmaterialy-i-tehnologii/csp

Как изготавливают ЦСП

Цементно-стружечная смесь, из которой изготавливают ЦСП – это своеобразный бетон на основе минерального вяжущего. Только вместо песка и щебня наполнителем в ней служит мелкая древесная стружка. Введение древесины в состав плиты снизило ее плотность, но главное – стружка сыграла роль не только легкого наполнителя, но и фибры – добавки, создающей объемное армирование, воспринимающее нагрузки на растяжение.

В смесь для изготовления плиты входят:

  • цемент – 65%;
  • стружка – 24%;
  • вода – 8,5—9%;
  • минерализующие и гидратационные добавки, – 2—2,5%.

Приготовление смеси начинается с измельчения стружки до нужного размера. После этого она делится на ситах на две фракции. Мелкую используют для формирования внешних слоев листа, более крупную – для среднего слоя. Затем ее обрабатывают хлоридом кальция, «жидким стеклом», хлоридом или сульфатом алюминия. Это необходимо для защиты материала от гниения и поражения грибком.

Просеянные и обработанные минеральными добавками стружки смешивают с водой и цементом. В воде растворяются добавки, ускоряющие твердение цемента. Кроме названных компонентов, в смесь в небольших количествах может добавляться мазут и индустриальное масло И-20 для снижения внутреннего трения и облегчения прессования.

Подготовленную смесь в три слоя выкладывают на поддоны, поддоны собирают в штабель и помещают в холодный пресс, где этот «пакет» сжимается до давления 1,8—6,6 МПа и фиксируется в таком состоянии замками. Специальная система замков сохраняет давление в пресс-форме после извлечения ее из пресса.

Сжатые пакеты подвергаются нагреву в течение 8 часов. За это время происходит ускоренная гидратация цемента и его твердение. Древесная стружка за счет своей упругости компенсирует усадку цемента, поэтому заданные размеры плит не изменяются. Разблокировка пресс-форм и снятие давление тоже происходит в прессе. После этого пакет раскрывается, а плиты извлекаются и на 1—2 недели помещаются в буферный склад.

Для окончательного дозревания материала он обдувается воздухом с температурой 70—100оС. После этого листы обрезаются по размеру, шлифуются, сортируются и передаются на склад готовой продукции.

Блок: 2/5 | Кол-во символов: 2140
Источник: https://srbu.ru/stroitelnye-materialy/1544-tssp-plita-kharakteristiki-i-primenenie.html

Где применяется цементно-стружечная плита

Плиты на основе цемента и стружки нашли широкое применение в «сухом» строительстве. Наиболее широко они используются для возведения зданий по каркасной схеме. Этому способствует способность плиты существенно повышать прочность каркаса (при правильном монтаже).

Другая причина высокой популярности ЦСП в высоких показателях безопасности материала. Ни в процессе нормальной эксплуатации, ни при пожаре композит не выделяет вредных летучих веществ. Он не поддерживает горение и не позволяет пламени распространяться по своей поверхности.

Широкое применение материал нашел в малоэтажном (до 3-х включительно) строительстве. Он отлично подходит не только для строительства коттеджей и частных домов, но и для зданий общего пользования: офисов, развлекательных центров, гостиниц, промышленных цехов. Высокая безопасность и экологичность цементно-стружечного композита позволяет использовать его на строительстве детских учреждений, школ, больниц, санаториев.

Еще одна сфера применения цементно-стружечных плит – возведение уличных построек в приусадебном хозяйстве. Хозблоки, бытовки, сараи, погреба, уличные туалеты, выстроенные из ЦСП, служат долгие годы благодаря высокой устойчивости материала к атмосферной влаге, колебаниям температуры, росту бактерий и плесневых грибков.

Низкая стойкость материала к деформации на изгиб несколько ограничивает его сферу применения. ЦСП либо укладывают на пол (на прочное основание), либо навешивают на каркас в строго отвесном положении. Класть этот материал под углом или использовать для оформления арочных конструкций нельзя!

Во внутренней отделке плиты на основе цемента и древесной стружки также нашли широкое применение. Из них делают внутренние перегородки, черновые полы, подоконники. Также с помощью ЦСП выравнивают поверхности стен и потолка.

Блок: 3/6 | Кол-во символов: 1832
Источник: http://stroyobzor.info/materialy/otdelka/cementno-struzhechnye-plity.html

Размеры и масса

При закупке материалов для строительных и отделочных работ важны такие характеристики как размеры и масса материала. Листы ЦСП выпускаются двух размеров: при ширине 1250 мм длина может быть 2700 или 3200 мм. При этом толщина плит ЦСП может быть 8, 10, 12, 16, 20, 24, 36 мм.

Плита ЦСП: область применения в зависимости от толщины

Понятное дело, чем толще плита, тем больше ее масса. Примерные значения массы приведены в таблице (у разных производителей могут быть отклонения как в сторону увеличения, так и в сторону уменьшения массы).

Вес цементно-стружечных плит в зависимости от размеров и толщины

Еще могут понадобиться такие параметры:

  • площадь одного листа:
    • 1250*2700 — 3,375 м²;
    • 1250*3200 — 4,0 м²;
  • вес кубометра ЦСП — 1300-1400 кг.

Лист ЦСП представляет собой однородный монолитный материал без воздушных вкраплений, что объясняет высокую теплопроводность материала. Это надо учитывать при разработке пирога утепления. Материал хорошо клеится с древесиной, полимерами и металлом, так что при строительных работах он удобен.

Блок: 5/7 | Кол-во символов: 1048
Источник: https://stroychik.ru/strojmaterialy-i-tehnologii/csp

Характеристики ЦСП

Основные характеристики ЦСП определяются входящими в ее состав компонентами. Например, тяжесть цементного камня частично компенсируется легкостью наполнителя – стружки.

Физико-механические показатели ЦСП согласно ГОСТ 26816-2016:

ПоказательЦСП-1ЦСП-2
Модуль упругости при изгибе, МПа 4500 4000
Твердость, МПа 45 — 65
Теплопроводность, ВТ/(м·0С) 0,26
Удельная теплоемкость, кДж/(кг·0С) 1,15
Удельное сопротивление выдергиванию шурупов из пласти, Н/м 4 — 7
Класс биологической стойкости 4
Морозостойкость:
— число циклов переменного замораживания/оттаивания без видимых признаков разрушения 50
— остаточная прочность, % 90
Стойкость к циклическим температурно- влажностным изменениям:
— снижение прочности при после 20 циклов температурно-влажностных воз­действий, % 30
разбухание по толщине, поле 20 циклов температурно-влажностных воздействий, % 5

Плотность и вес плиты

Плотность ЦСП составляет 1100—400 кг/м3 – это меньше, чем плотность большинства материалов на основе цемента. Плита размерами 3200х1200х10 мм весит от 42 до 54 кг в зависимости от плотности.

Воздействие влаги и биостойкость

ЦСП устойчива к влаге и биологическим факторам. Биостойкость обеспечивается специальной обработкой стружки – минерализацией. Влагостойкость – это заслуга цемента. Цементный камень не теряет прочности при любом увлажнении. Водопоглощение при длительном погружении в воду не превышает 16 %, а разбухание плиты по толщине укладывается в 1,5 %.

Морозостойкость

При увлажнении ЦСП мало впитывает воду. Этим определяется ее хорошая устойчивость к низким температурам. Морозостойкость ЦСП – 50 циклов замораживания-прогрева без видимых повреждений и при 90 % остаточной прочности. По этому параметру плиты пригодны для применения вне отапливаемых помещений при условии защиты от накопления влаги.

Теплопроводность и паропроницаемость

Цементно-стружечная плита – пористый материал, поскольку значительную часть объема в ней занимает древесная стружка. Благодаря такой структуре она имеет невысокую теплопроводность – около 0,26 Вт/(м∙°С). Это в 1,5—2 раза меньше, чем у кирпича и примерно вдвое больше, чем у гипсокартона. Несмотря на то, что ЦСП нельзя в полной мере считать теплоизолирующим материалом, ее использование существенно влияет на результирующее тепловое сопротивление внешних ограждающих конструкций.

Пористая структура обуславливает проницаемость материала для водяного пара на уровне 0,03 мг/(м∙ч∙Па). Такую же паропроницаемость имеет бетон. Этот параметр обязательно учитывается при проектировании многослойных стен. При применении ЦСП плиты для внутренней отделки внешних стен, она может служить пароограничивающим слоем, уменьшающим накопление влаги в стене и повышающим эффективность теплоизоляции.

Пожарная безопасность

Пожарные характеристики ЦСП таковы:

  • группа горючести: Г1: трудногорючие;
  • группа воспламеняемости: В1 – трудновоспламеняемые;
  • распространение пламени: РП1 – не распространяющие пламя;
  • дымообразование: Д1 – малое количество дыма;
  • группа токсичности: Т1 – продукты горения малотоксичны.

По сумме параметров цементно-стружечная плита относится к безопасным материалам. Ее использование позволяет повысить огнестойкость строительных конструкций и снизить класс пожарной опасности помещений.

Экологичность

Этой характеристике уделяется очень большое внимание в связи с массовым использованием в производстве стройматериалов синтетического сырья. Цементно-стружечная плита состоит только из природных компонентов. В ней не содержатся формальдегидные смолы, полистирол и другие вещества, которые могут служить источниками эмиссии летучих токсичных соединений. Благодаря минерализирующим добавкам, древесная компонента неподвержена гниению, что тоже способствует сохранению в помещениях здоровой атмосферы.

Обработка

Цементно-стружечная плита достаточно легко режется и сверлится, что существенно упрощает работу с ней. На ее поверхность хорошо ложатся шпаклевки, она хорошо окрашивается.

Блок: 4/5 | Кол-во символов: 3906
Источник: https://srbu. ru/stroitelnye-materialy/1544-tssp-plita-kharakteristiki-i-primenenie.html

Монтаж плиты ЦСП своими руками. Пошаговая инструкция

Перед началом монтажа следует составить проект. Он позволит понять сколько листов потребуется укрепить, где у каждого листа будут находиться крепежные элементы, на какие куски придется резать купленную плиту. Перед работой требуется тщательно продумать, как будет удерживаться плита на своем месте до полной фиксации. Поскольку цементно-стружечный композит весьма тяжел, стоит продумать возможность применения подъемных механизмов.

В работе с ЦСП, как никогда, важна каждая пара рук. Поэтому начинать работу одному категорически не рекомендуется. Лучше работать с хотя бы одним помощником.

Порядок действий таков:

  • Ориентируясь на составленный проект, нарезаем плиту на куски нужного размера. Режется цементно-стружечный композит теми же инструментами, что и обычная ДСП, но пилки нужны более твердые.
  • На каждом куске сверлим отверстия под саморезы.
  • Прикладываем кусок к каркасу, проверив отвесность с помощью уровня.
  • Вкручиваем саморезы по углам, затем по периметру и посередине.
  • Закрепляем куски один за другим, пока обшивка не будет выполнена. Дальше заделываем швы герметиком или закрываем специальной рейкой.

В здании ширина шва – не менее 0,4 см, снаружи – не менее 0,8. Иначе стыки начнут трескаться.

Остается только покрасить плиту или оштукатурить для нанесения чистовой отделки.

Блок: 5/6 | Кол-во символов: 1343
Источник: http://stroyobzor.info/materialy/otdelka/cementno-struzhechnye-plity.html

Советы профессионалов

Любое дело лучше получается, если использовать практические наработки. Такой багаж ценных знаний об особенностях выбора и монтажа ЦСП можно приобретать на собственном опыте, но ошибки приведут к задержкам в строительстве и финансовым потерям. Поэтому мы предлагаем посмотреть несколько полезных видеофрагментов, чтобы ознакомиться с опытом профессиональных строителей:

Использование современных отделочных материалов позволяет выполнить строительные работы гораздо быстрее, не разводя лишней грязи и получая в итоге прекрасный результат. Как раз такие возможности предоставляет строителю использование ЦСП.

Однако перед началом работы стоит ознакомиться со всеми особенностями этого материала. Это поможет не ожидать от него невозможного и избежать досадных ошибок в монтаже. Надеемся, что советы, содержащиеся в этой статье, помогут вам в работе!

Блок: 6/6 | Кол-во символов: 873
Источник: http://stroyobzor.info/materialy/otdelka/cementno-struzhechnye-plity.html

Методы обработки и отделки

Несмотря на то что цементно стружечная плита намного прочнее ДСП, обрабатывается она теми же инструментами: фрезером, пилой, электролобзиком. Разница в том, что использовать надо более прочные пилки.

Для сверления рекомендуется использование сверла с твердым наконечником. Использовать можно как ручную, так и электрическую дрель. Шлифовать этот материал не рекомендуется, так как при этой работе снимается верхний слой, что увеличивает водопоглощение. Но при стыковке иногда возникает необходимость выравнивания высоты. В этом случае можно использовать шлифовальные машины любого типа. Рекомендуемое зерно наждачной бумаги — №16-25.

Швы при монтаже плит ЦСП

Обратите внимание, что для того чтобы швы между плитами не трескались, при внутренней отделе шов должен быть не менее 4 мм, при наружной — не менее 8 мм. Расстояние большое, может закрываться специальными рейками (обычно используется при наружной отделке) или при помощи эластичной ленты или герметика.

В качестве финишной отделки плита ЦСП может быть покрашена или покрыта штукатуркой. При наружной отделке стыки между плитами часто просто прокрашивают, оставляя их незаделанными. Еще вариант — использование алюминиевой профильной накладки, которая подчеркивает швы. Также можно закрыть шов нащельной рейкой.

Как заделать шов между плитами ЦСП при наружной или внутренней отделке

Для внутренней отделки шов заполняют герметиком, который после высыхания сохраняет эластичность. После этого можно штукатурить. Второй вариант — прокладка специального эластичного шнура, поверх которого снова-таки наносится эластичная штукатурка.

Блок: 7/7 | Кол-во символов: 1644
Источник: https://stroychik.ru/strojmaterialy-i-tehnologii/csp

Кол-во блоков: 10 | Общее кол-во символов: 13099
Количество использованных доноров: 3
Информация по каждому донору:
  1. https://srbu.ru/stroitelnye-materialy/1544-tssp-plita-kharakteristiki-i-primenenie.html: использовано 2 блоков из 5, кол-во символов 6046 (46%)
  2. https://stroychik.ru/strojmaterialy-i-tehnologii/csp: использовано 3 блоков из 7, кол-во символов 3005 (23%)
  3. http://stroyobzor.info/materialy/otdelka/cementno-struzhechnye-plity.html: использовано 3 блоков из 6, кол-во символов 4048 (31%)

Новое.

Обои, панели, ДВП, ДСП, МДФ на интернет-аукционе Au.ru

Цена указана за штуку. Описание: Цементно-стружечная плита (ЦСП) – это универсальный материал для внутренних и наружных работ, который превосходит любой листовой материал на основе древесины (ДСП, ОСП). Достоинства: * Отличные тепло- и звукоизолирующие качества. * завидная прочность * пожаростойкость * отсутствие коробления или усадки * непревзойденная гладкость * устойчивость к гниению, термитам и грибкам. Благодаря этому ЦСП можно красить, оштукатуривать, отделывать керамикой (плиткой) или сайдингом. Состав: Толщина плиты 10 мм Длина 3600 мм Ширина 1200 мм Монтаж ЦСП: 1. По обрешетке из деревянных брусков при помощи гвоздей или шурупов. 2. По металическим профилям с использованием саморезов. Применение ЦСП: Наружная и внутренняя отделка зданий Плиты толщиной 10,12 и 16 мм применяют в качестве наружной и внутренней обшивки стен (по каркасу-обрешетке), облицовки колонн или ригелей общественных, промышленных и сельскохозяйственных зданий. Каркас может быть металлический или деревянный. Обшивки крепятся к каркасу-обрешетке, смонтированной из деревянных брусков или металлических профилей. ЦСП успешно применяется при внутренней отделке стен. Экологически чистые плиты создают ровные поверхности стен и межкомнатных перегородок. Плиты используются в качестве внутренних покрытий стен в помещениях с сухим, нормальным и влажным режимом жилых, гражданских и промышленных зданий. Утепление существующих зданий Такой вариант утепления не требует больших капитальных вложений. Трудозатраты на выполнение этих работ незначительны. Суть метода заключается в создании обрешетки из деревянных брусков 50х80х (50х50) мм, на которую крепятся плиты толщиной 12 или 16 мм. Между стеной и ЦСП укладываются теплоизоляционные материалы. Зазоры между цементно-стружечными плитами допускается оставлять до 10 мм. Стыки должны быть герметизированы уплотнительными прокладками или эластичными мастиками. Поверх стыков крепятся нащельники, которые могут быть выполнены из имеющихся материалов: ЦСП, древесины, металлов. Влагостойкие перегородки Плиты толщиной 12 и 16 мм применяются во влагостойких перегородках. Это обусловлено высокими физико-механическими свойствами материала. ЦСП можно использовать в перегородках санитарных узлов зданий следующего назначения: общественные, промышленные, сельскохозяйственные, временные контейнерные и сборно-разборные. Плиты необходимо грунтовать и покрывать окрасочными составами, пригодными для влажностного режима эксплуатации. Для того, чтобы не было неравномерного водонасыщения плит, необходимо уделить внимание защите кромок водоотталкивающими составами. Ограждение балконов. Облицовочные детали Плиты толщиной 12 и 16 мм используются в качестве ограждений лоджий, балконов. По сравнению с асбестоцементными листами, ЦСП не является хрупким материалом. Возможно использование плит для устройства огнестойких дверей. Металлические двери обшиваются ЦСП с одной или двух сторон, что позволит создать преграду для распространения огня. Например: ЦСП толщиной 16мм имеет предел огнестойкости 30 минут. Несъемная опалубка Плиты толщиной 12,16 и 24 мм могут использоваться в качестве элементов опалубки для устройства фундаментов малоэтажных зданий. Плиты не деформируются при укладке бетонной смеси, так как обладают высокой прочностью и жесткостью. Простота конструкции опалубки позволит снизить трудозатраты при выполнении фундаментальных работ. Плиты могут играть роль вертикальной гидроизоляции, если их наружную поверхность покрыть окрасочными или оклеечными материалами. Подоконные доски Подоконники из ЦСП идеально подходят для любого современного интерьера. По своим характеристикам подоконник из ЦСП прочен как аналог из дерева, а по цене в несколько раз дешевле. Полы Цементно-стружечные плиты толщиной 16,24 и 36 мм могут выступать в качестве следующих элементов полов: - основания под полы, подстилающие слои; - выравнивающие слои, чистые полы с лицевым покрытием. Если полы из ЦСП устраиваются по лагам, то их шах принимается 600мм, а минимальное сечение 50х80 мм. Плиты 24 и 36 мм можно использовать при устройстве быстровозводимых полов по насыпным грунтам в складских и подсобных помещениях. При этом исключаются мокрые процессы, что позволяет вести работы при отрицательных температурах. Кроме того, плиты могут заменить цементную стяжку. Достоинствами этого решения являются: сокращение трудоемкости работ; отсутствие пыли и грязи; возможность вести ремонтные работы, не останавливая производство. Основание под мягкую кровлю Плиты толщиной 16 и 24 мм могут служить основанием под мягкую кровлю. В этом случае перед наклейкой рулонного ковра на стыки плит сверху накладываются подкрепляющие полосы из жесткого листового материала. Далее на все стыки плит наклеиваются полосы из кровельного рулонного материала. После этого производят наклейку рулонного ковра. Итак, из плит могут быть выполнены следующие облицовочные детали: 1. Подоконные плиты: 24, 36 мм; 2. Сухая стяжка при монтаже плоской кровли: 12,16, 20, 24 мм; 3. Обкладка ригелей, колонн: 8,10, 12, 16 мм; 4. ЦСП для пола: 20, 24, 36 мм; 5. Обшивка наружных каркасных стен:10, 12, 16, 20, 24мм; 6. Пол чердака:12, 16, 24; 7. Обшивка каркасных перегородок:8, 10, 12, 20, 24мм. 8. Ветровые доски, наличники, плинтусы. Остались вопросы? Звоните нашему менеджеру по телефону 8 (391) 271-91-71 и получите бесплатную консультацию. Или оставляйте заявку на почту [email protected] Характеристики: Толщина: 10 мм Размеры: 1200х3600 Страна-производитель: Россия

Обязательно сообщите менеджеру, что нашли товар на площадке АУКЦИОН. Предварительно согласуйте покупку по телефону 22-32-600, 8-967-612-40-63 Viber, WhatsApp. ул. Башиловская 2, офис 110 Оплата: наличный расчет, безналичный расчет

Согласовывается с менеджером по телефону или лично в офисе.

Красноярск, Зелёная Роща

Увеличить карту

Поделиться этим лотом:

Цементно-стружечные плиты в Краснодаре

+7 (900) 232-55-00
+7 (953) 085-33-88

Цементно-Стружечные Плиты ЦСП

Прайс-лист, описание

 

 
Размеры листа Толщина  Вес  листа  Площадь листа  Вес  пачки 

Кол-во листов 
в пачке

     Цена от      7-ми  пачек 

     Цена от     1-ой  пачки  Цена от 15 шт. до 1-ой пачки Цена от 1 до 15-ти листов
фурой вагоном
мм мм кг м2 кг шт шт руб руб руб руб
2700*1200
10 43 3,24 3010 70 62 дог. дог. 1350 1400
12 51 3,24 2960 58 52 дог. дог. 1500 1560
16 68 3,24 2920 43 39 дог. дог. 1790 1850
20 85 3,24 2980 35 31 дог. дог. 2120 2200
24 102 3,24 2960 29 26 - - - -
 
3200*1250 10 52 4,0 3432 66 дог. дог. 1520 1590
12 62 4,0 3410 55 дог. дог. 1700 1760
16 82 4,0 3362 41 дог. дог. 2080 2200
20 103 4,0 3399 33 - - - -
24 123 4,0 3321 27 - - - -


 

Скачать Характеристики ЦСП 

Структурированные Плиты ЦСП

Прайс-лист, описание

Фасадные Цементно-Стружечные Плиты соединили в себе прекрасные физико-механические характеристики обычных цементно-стружечных плит, производимых по ГОСТ 26816-86, высокие показатели пожарной, химической, биологической, радиологической безопасности и прекрасный внешний вид.  


Новинка! МАГМА с графитовым швом! Новинка! МАГМА с графитовым швом! Новинка! МАГМА с графитовым швом!

 
Цены на Фасадную окрашенную и Структурированную Плиту ЦСП (Скачать)
Наименование, фото Размеры
листа
Тол-
щина
Вес
листа
Пло-
щадь
листа
Вес
пачки
Колич-во
листов
в
пачке
Цена за лист
транзит
(от фуры)
Цена за лист
от 1-ой
пачки
Цена за лист
от 15-ти шт.
до пачки
Цена за лист
от 1 до 15-ти
листов
мм   кг м2 кг шт руб
лист/м2
руб
лист/м2
руб
лист/м2
руб
лист/м2
Структурированная
Неокрашенная
(малый кирпич в разбежку)
3057*1238 12 59 3,78 2950 36 2390/632 2450/648 2550/675 2650/701
Структурированная
Неокрашенная
(малый/большой кирпич)
2780*1230 12 54 3,42 2700 36 2340/684 2400/702 2490/728 2590/757
Структурированная
Окрашенная
(малый кирпич в разбежку)
482*1125 12 9 0,54 - 50 Дог. 620/1150 655/1215
622*1125 12 0,7 805/1150 850/1215
898*1125 16 1,01 1160/1150 1230/1215
1520*1230 30 1,87 1500 50 1890/1011 1950/1043 2000/1070 2060/1102
Структурированная
Окрашенная
(малый/большой кирпич)
592*1230 12 12 0.73 583 50 Дог. 840/1150 887/1215
1390*1230 27 1,71 1485 55 1740/1018 1790/1047 1850/1082 1910/1117
Гладкая
Окрашенная

   

1590*1250 8 21 1,99 1470 70 1510/759 1560/784 1620/814 1680/844
1590*1250 10 26 1,99 1560 60 1610/809 1660/834 1720/864 1770/889
1590*1250 12 32 1,99 1760 55 1710/859 1750/879 1820/915 1860/935

Скачать Прайс-лист ЦСП Структурированная и гладкая окрашенная 

О товаре

     Наша компания занимается комплексным снабжением строительных организаций и индивидуальных застройщиков всем необходимым для их бесперебойной работы.
     На данной странице мы  представляем Цементно-Стружечные Плиты  (ЦСП) Производство г.Кострома, которые уже более 30-ти лет производятся на территории РФ и нашли широкое применение в каркасном домостроении,  при возведении объектов промышленного и сельскохозяйственного назначения, для утепления зданий, при монтаже перегородок в сухих и влажных помещениях, для несъемной опалубки и т.д.
     ЦСП изготавливают путем прессования отформованной смеси, состоящей из древесной стружки, портланд-цемента, воды и гидратационных добавок. Её высокое качество обеспечивается строгим контролем в соответствии с ГОСТом (26816-86), а такие свойства, как влагостойкость, пожаробезопасность, морозостойкость, отсутствие вредных примесей, долговечность,  делают ЦСП уникальным строительным материалом среди аналогов.
     

Цементно-стружечная плита: применение, технические характеристики, размеры

Главная / Статьи / Цементно-стружечная плита

Цементно-стружечная плита (ЦСП) - это листовой строительный и отделочный материал, который изготавливается методом прессования цементно-стружечной смеси. Она широко используется в строительстве, а также во внутренней и внешней отделке. Основным нормативом является ГОСТ 26816-2016. Размеры и технические требования к продукции, изложенные в данном документе, соответствуют европейским стандартам EN 634-1:1995 (ч. 1) и EN 634-2:2007 (ч.2).

1. Состав и структура ЦСП
2. Характеристики
3. Технология производства
4. Преимущества цементно-стружечных плит
5. Применение ЦСП
6. Что необходимо учитывать при работе с ЦСП

Состав и структура ЦСП

По объему

  • 66 % - деревянная стружка;
  • 21 % - портландцемент М500;
  • 10 % - вода;
  • 3 % - гидратационные добавки и модификаторы.

ЦСП имеет 3–4 слоя. Для внутренних используются опилки бóльшей длины, для наружных - меньшей. Такая неоднородная структура придает материалу прочность и упругость и обеспечивает гладкую поверхность конечного изделия.

Характеристики

Размеры. Плиты выпускаются длиной 2700, 3200 и 3600 мм, шириной 1200 и 1250 мм. Толщина варьируется в пределах от 8 до 40 мм, с шагом 2 мм. Возможен выпуск ЦСП других размеров под индивидуальные требования заказчика.

Физико-механические параметры.

  • Плотность - 1100–1400 кг/м³, что делает цементно-стружечные плиты самым тяжелым листовым материалом.
  • Коэффициент теплопроводности - 0,26 Вт/(м·К). Температурное сопротивление (м2·°C/Вт) - 0,031–0,138 в зависимости от толщины плиты (чем толще плита, тем выше показатель).
  • Предел прочности на растяжение - не менее 0,35–0,40 МПа, на изгиб - не менее 7–12,9 МПа в зависимости от типа и толщины ЦСП.
  • Влажность в пределах 6–12 %, водопоглощение за сутки - не более 16 %.
  • Морозостойкость - не менее 50 циклов.

Технология производства

Подготовка стружки. Для изготовления ЦСП может быть использована только вылежавшаяся сухая стружка. Она разделяется на две фракции: мелкую, которая идет на внешние слои, и более крупную (на внутренние). Просеянное сырье обрабатывают солями натрия, кальция или алюминия, чтобы заполнить капилляры древесины минералами и снизить таким образом ее способность к поглощению влаги. Помимо этого, обработка проводится с целью превращения растворимых сахаров древесины, в чистом виде меняющих время твердения цемента, в нерастворимые соединения. Стружку выдерживают в растворах солей не меньше суток.

Подготовка водного раствора. Обычная вода не может быть использована, т. к. даже после обработки гидратационными растворами в древесине могут оставаться сахара, вступающие в реакцию с водой и снижающие качество цементного камня. Поэтому в воду вводят те же соли, что используются для обработки стружки (силикат натрия, хлорид кальция, сульфат алюминия), в пропорциях, зависящих от степени предварительной обработки, породы древесины, качества воды и прочих факторов.

Приготовление рабочей смеси. Подготовленные стружки и опилки смешиваются с цементом и водным раствором в бетоносмесительных установках. При этом смешивание стружек различных фракций происходит отдельно, в разных БСУ.

Формование. Подготовленная цементно-стружечная смесь выкладывается в три слоя на поддоны, в процессе выкладки проводится взвешивание для определения точного количества (при необходимости смесь добавляют до нужного количества либо убирают излишки). Затем поддоны поступают на вибрационный стенд для уплотнения, удаления пузырьков воздуха из смеси и максимально полного заполнения формы. После уплотнения смесь подвергается прессованию до необходимой толщины.

Температурная обработка. Сжатые пакеты поддонов, в зависимости от технологии и оборудования, обрабатываю паром при температуре +80…+100 °С в течение 6–16 часов. Такие условия приводят к ускоренной гидратации и отверждению цементной смеси. Габариты плиты не изменяются.

Завершающая обработка. Плиты извлекаются из пресс-форм и отправляются на буферное складирование для последующего дозревания. Для этого ЦСП обдуваются горячим воздухом +70…+100 °С. Затем листы обрезаются по размерам, проходят шлифовку и сортировку.

Важно знать. Цементно-стружечные плиты выпускаются двух категорий: ЦСП-1 и ЦСП-2. Продукция первого вида отличается лучшими характеристиками: меньшим отклонением от размеров (±3,0 мм против ±5,0), бóльшим пределом прочности на изгиб (9,0–12,0 МПа против 7,0–9,0 МПа), меньшей шероховатостью (80 и 100 мкм) и т. п.

Преимущества цементно-стружечных плит

Экологическая безопасность. В производстве ЦСП используется безвредное сырье: портландцемент, древесная стружка, соли металлов. В процессе изготовления происходит полная минерализация компонентов, что делает невозможным выделение готовым изделием газов или пыли. Материал безопасен для человека и окружающей среды, в том числе при нагревании.

Пожарная безопасность. ЦСП не горит, не поддерживают и не распространяют горение, не выделяет токсичных дымов и паров. Это позволяет устанавливать цементно-стружечные плиты в помещениях с повышенными пожарными требованиями.

Надежность. ЦСП являются материалом, придающим каркасу жесткость, и могут применяется в многоэтажных зданиях и в сейсмоопасных районах (успешно прошли вневедомственную экспертизу и экспертизу ЦНИИСК).

Биостойкость. В процессе превращения цемента в бетон при изготовлении ЦСП в самой массе образуется гидроксид кальция - естественный антисептик. Благодаря этому в материале не образуется плесень, а его структура позволяет противостоять воздействию насекомых и грызунов.

Влагостойкость. Плиты не впитывают влагу и при монтаже снаружи дополнительно защищают здание от атмосферных явлений. Также это позволяет использовать ЦСП для отделки влажных помещений. Морозостойкость. Это свойство позволяет применять материал в серверных регионах - снижения прочности на изгиб после 50 циклов не превышает 10%.

Применение ЦСП

 

ЦСП используются в ходе строительства и реконструкции жилых домов, а также различных зданий и сооружений промышленного, гражданского или сельскохозяйственного назначения. Наиболее распространены следующие способы применения.

Возведение наружных и внутренних стен и перегородок. ЦСП, имеющие толщину 10–16 мм, используются для создания наружной и внутренней обшивки по металлической или деревянной обрешетке. В результате образуется жесткий каркас, использование которого допустимо в том числе в сейсмоопасных районах.

Устройство плоской кровли. ЦСП используется в качестве сборной стяжки под рулонное покрытие, в том числе в регионах с высокой снеговой нагрузкой. Это позволяет обеспечить ровную укладку рулонного покрытия, отсутствие мокрых процессов в дальнейшем. Применение ЦСП дает возможность организовать эксплуатируемую кровлю.

Устройство несъемной опалубки. Несъемная опалубка с элементами из ЦСП используется при устройстве фундаментов, возведении стен, мансардных стен и перекрытий в домах разной этажности.

Устройство «плавающего пола». Это пол из ЦСП, уложенный на звукоизоляционном слое, не имеющий жёстких связей с несущей частью перекрытия и другими конструкциями здания. Его основные преимущества - высокая скорость монтажа, повышение звукоизоляции, а также влаго- и биостойкость.

Устройство перекрытий. ЦСП толщиной 12–36 мм могут использоваться как в качестве чернового пола по лагам, профлисту, старому деревянному основанию и др., так и в качестве подстилающего или выравнивающего слоя и даже чистового пола (с последующим монтажом лицевого покрытия).

Облицовка при создании вентилируемых фасадов. Плиты толщиной 8–12 мм монтируются на деревянную или металлическую обрешетку, между ними и стеной укладываются теплоизоляционные материалы. Такое применение ЦСП позволяет повысить энергоэффективность как старых, так и новых зданий.

Интерьер. Помимо строительства и черновой отделки, ЦСП используются и в чистовой, в частности, для создания интерьеров в стиле лофт или хай-тек. Их применение позволяет значительно сократить сроки обустройства помещения. Древесная основа плит позволяет забивать в поверхности гвозди, вкручивать саморезы, размещать на стенах, отделанных ЦСП, предметы интерьера. Плиты могут использоваться в том числе во влажных помещениях.

Что необходимо учитывать при работе с ЦСП

Следует уяснить, что цементно-стружечная плита сильно отличается от других древесно-композитных материалов, таких как ДСП или ДВП. Процентное содержание стружки в ЦСП не превышает 25 %, поэтому материал по своим физическим свойствам и эксплуатационным характеристикам ближе к бетонным изделиям, чем к дереву.

Большой вес. Это означает, что при работе с цементно-стружечной плитой требуется не меньше двух человек, так как для одного это будет очень затруднительно. Кроме того, использование ЦСП, например, для облицовки фасада, ведет к значительному утяжелению конструкции. Поэтому перед началом облицовочных работ следует обязательно выяснить максимальную нагрузку, на которую рассчитаны несущие стены, перекрытия и фундамент дома.

Хрупкость. Плиты требуют более аккуратного и бережного отношения, чем ДВП- и ДСП-панели. Например, их переноска должна осуществляться только в вертикальном положении, перпендикулярно к земле, а в горизонтальном следует хранить.

Резка. При раскрое ЦСП выделяется много цементной пыли, поэтому все работы следует осуществлять на открытом воздухе или в помещении с хорошим естественным воздухообменом либо вытяжной вентиляцией. При резке необходимо использовать средства индивидуальной защиты, как минимум респиратор.

Инструменты. ЦСП - это больше цемент, чем древесина, поскольку значительно превосходит ее по прочности. Однако для ее обработки используется практически аналогичный инструмент, однако его режущие поверхности должны быть выполнены из твердого сплава. ЦСП режется, фрезеруется, шлифуется и сверлится.

Крепеж. Для монтажа ЦСП используются гвозди или саморезы. Для последних предварительно рассверливаются отверстия несколько большего диаметра, чем крепеж. Это делается, чтобы предотвратить вкручивание в плиту вплотную и снизить вероятность сколов или трещин. Все виды соединительных элементов должны обладать антикоррозийной поверхностью. Оцинкованное покрытие предотвращает коррозию, тем самым окрашенная поверхность ЦСП защищена от проявления ржавчины.

Важно. Хрупкость ЦСП и низкая прочность на изгиб предъявляют высокие требования к основанию: оно должно быть ровным, без перепада высот.

Страница не найдена - Титан Экологическое Сдерживание Лтд.

Уважаемые клиенты и партнеры, По мере того, как мы ориентируемся в текущей ситуации с COVID-19, благополучие наших клиентов, сотрудников и семей по-прежнему остается нашим главным приоритетом. В соответствии с руководящими принципами, установленными властями провинции, Titan определен как предприятие, оказывающее «основные услуги», и продолжает работать в полную силу без каких-либо изменений в позиции правительства. При этом мы по-прежнему стремимся служить вам и хотим заверить вас, что мы, как бизнес, действуем ответственно и принимаем необходимые меры социального дистанцирования и санитарные меры для обеспечения безопасности всех.Вот что мы делаем: Повседневная деятельность

  • Мы сокращаем количество сотрудников в офисе до минимума за счет ротации сотрудников, работающих на дому.
  • Мы внедрили процессы внутренней очистки для часто используемых офисных поверхностей.
  • Мы просим клиентов, которым необходимо забрать заказы, позвонить заранее, чтобы запланировать получение.
  • Мы просим водителей транспортных средств, собирающих или доставляющих материалы, звонить нам по прибытии для погрузки или разгрузки.Это необходимо для того, чтобы доставка и получение осуществлялись без личного общения.
  • Мы не собираем бумажные копии документов, подписи вручную или личные платежи. Все документы по заказу / доставке обрабатываются в электронном виде, а необходимые платежи обрабатываются по телефону с помощью кредитной карты.
ПРИМЕЧАНИЕ: Текущая перегрузка в телекоммуникационных сетях может вызвать проблемы при общении или попытках связаться с персоналом, который работает из дома с сотовыми устройствами.Если у вас возникнут проблемы, попробуйте еще раз. Мы ценим ваше терпение в течение этого времени. рабочих мест проекта
  • Мы внедрили несколько методов предотвращения COVID-19 для всех наших рабочих мест, в том числе:
    • Часто мыть руки теплой водой с мылом, а также до / после еды, питья или курения. Если возможно, используйте дезинфицирующее средство для рук.
    • По возможности всегда носить перчатки.
    • Дезинфекция всех ручных инструментов и оборудования до и после использования.Используйте дезинфицирующие салфетки.
    • Практика социального дистанцирования - отсутствие рукопожатий или близкого контакта с другими и соблюдение 6 футов расстояния от других работников.
    • Ношение масок N95, если социальное дистанцирование невозможно.
    • Работа в небольших группах и дистанцирование от других профессий и персонала.
    • Обзор политики безопасного труда по предотвращению COVID-19 и реагированию на пандемию со всеми работниками. Полная информация доступна здесь: https: // www.titanenviro.com/wp-content/uploads/2020/04/COVID-19-Prevention-SWP-2020Mar31. pdf
Как всегда, запросы на расценки можно отправить на нашем веб-сайте, по электронной почте или позвонив в наш офис. Мы сделаем все возможное, чтобы поддерживать высокий уровень оперативности, которого вы ожидаете от нас. Благодарим вас за сотрудничество в течение этого времени и обновим это сообщение, чтобы отразить любые будущие изменения. Пожалуйста, берегите себя и оставайтесь в безопасности. Команда Titan Environmental Conservation

Наука похудания

Отправлено 11 июня 2018 г. | Автор: csponline

Если вы чувствуете, что у вас избыточный вес, и вы хотите сбросить несколько килограммов, вы не одиноки.

Опрос, проведенный Gallup в 2016 году, показал, что 53 процента американцев хотели бы похудеть, согласно опросу, проведенному в период с 2010 по 2016 год. Но похудеть непросто, особенно с возрастом. Чтобы увидеть результаты, нам нужна мотивация, изменение образа жизни и иногда даже поездка к врачу.

Есть три основных аспекта похудания: питание, сон и упражнения. Когда вы объедините внимание ко всем трем, у вас больше шансов увидеть результаты.

Наука о похудании доказывает, что эти три аспекта играют важную роль в том, как наше тело накапливает жир и как мы можем его удалить.Улучшение пищевых привычек, хороший ночной сон и регулярные физические упражнения показали положительные результаты по всем направлениям как в научных исследованиях, так и в личных анекдотах со всей страны.

Питание

Соблюдение правильной диеты может существенно повлиять на ваше общее состояние здоровья и помочь сбросить вес.

Министерство здравоохранения и социальных служб США обнаружило, что типичная американская диета превышает рекомендуемые уровни потребления калорий из твердых жиров и добавленных сахаров, рафинированного зерна, натрия и насыщенных жиров.Кроме того, около 90 процентов американцев потребляют больше натрия, чем рекомендуется в рамках здоровой диеты, а сокращение потребления натрия позволит сэкономить до 20 миллиардов долларов в год на общенациональных медицинских расходах.

Национальный институт сердца, легких и крови США рекомендует план здорового питания, в котором «упор делается на овощи, фрукты, цельнозерновые продукты, а также обезжиренные или обезжиренные молочные продукты. Что касается белков, он рекомендует постное мясо, птицу, рыбу, бобы, яйца и орехи, ограничивая при этом трансжиры, натрий и добавленный сахар.

Существует множество различных диет, которые помогут вам сбросить вес. К ним относятся:

  • Кето: кетогенная диета с низким содержанием углеводов, умеренным содержанием белка и высоким содержанием жиров. Он основан на предположении, что человеческое тело было создано для более эффективного сжигания жира, а не сахара, который содержится в углеводах.
  • Палео: Эта диета богата белками (мясо, рыбные орехи) и овощами (листовая зелень, сезонные овощи) и семенами. Все, что обработано, например, крупы для макаронных изделий или конфеты, не используется.Ешьте, как пещерные люди.
  • South Beach: Эта диета утверждает, что у вас есть ответ - иметь собственное тело South Beach. В нем много белков и полезных жиров, но мало углеводов, хотя вам не нужно полностью исключать их из своего рациона.
  • Веганский: это диета, основанная на растительных продуктах и ​​напитках, исключающая все продукты животного происхождения, включая яйца и молочные продукты. Это не обязательно с низким содержанием углеводов, поскольку вы все равно можете есть обработанные зерна, такие как хлеб и макароны, но при этом исключаются белки животного происхождения.
  • Дюкан: Диета Дюкана - это с высоким содержанием белка, низким содержанием жиров и низким содержанием углеводов. Он разработан с учетом постоянного изменения образа жизни, которое поможет вам достичь своего «истинного веса» и удерживать его на прежнем уровне.

Контроль порций также является важной частью здорового питания, так как вы не должны переедать.

Институт также рекомендует тем, кто хочет сбросить 1–1,5 фунта. в неделю следует снизить суточную калорийность на 500-750 калорий.

Питьевая вода до и во время еды также может помочь в похудании, а также в поддержании правильного питания.

Исследование Национальной медицинской библиотеки США показало, что употребление около 17 унций воды помогло повысить метаболизм на 24–30 процентов в течение 60–90 минут, а употребление того же количества воды примерно за полчаса до еды. помогли людям, сидящим на диете, съесть меньше калорий и сбросить на 44 процента больше веса.

Упражнение

Помимо диеты, добавление регулярных упражнений в свой распорядок дня может помочь вам похудеть.

Существует так много разных способов тренировок, в зависимости от вашего типа телосложения, от того, сколько вы хотите сбросить и хотите ли вы также нарастить мышцы.

Многочисленные исследования показали положительные результаты физических упражнений. Доказано, что благодаря высвобождению гормонов, таких как эндорфины, упражнения снижают стресс, повышают продуктивность на работе и снижают риск сердечных заболеваний, диабета и ожирения, а также других заболеваний.

Что касается похудания, то одним из наиболее эффективных способов сжигания жира является кардио. Это включает в себя бег, ходьбу, езду на велосипеде, плавание и любую деятельность, при которой ваше сердце бьется выше обычной частоты пульса в состоянии покоя.Силовые тренировки, аэробика и поднятие тяжестей могут привести к потере веса.

Исследование 141 человека с ожирением показало, что участники, которые сжигали 400 калорий с помощью кардиоупражнений пять раз в неделю, потеряли 4,3 процента веса своего тела, а участники, которые сжигали 600 калорий пять дней в неделю, потеряли 5,7 процента веса своего тела.

К счастью, вам не нужно делать это в одиночку. Как в Интернете, так и в тренажерных залах по всей стране есть программы по снижению веса, к которым вы можете присоединиться, которые помогут мотивировать вас на достижение вашей цели.

Загрузите наше бесплатное руководство по карьере в области науки о физических упражнениях.

Узнайте о лучших профессиях в области науки о физических упражнениях с помощью нашего бесплатного руководства по карьере в области науки о физических упражнениях 2018.

Получить руководство

Сон

Согласно опросу, проведенному Центрами по контролю за заболеваниями в 2016 году, более трети взрослых американцев не высыпаются каждую ночь.

Взрослым от 26 до 64 необходимо спать от семи до девяти часов в сутки. Но когда мы не высыпаемся, мы увеличиваем риск плохого состояния здоровья, такого как высокое кровяное давление, сердечные заболевания и инсульт, - говорится в сообщении CDC.

Наша инфографика о сне помогает объяснить, как недостаток сна приводит к проблемам с настроением и поведением на следующий день, а также как исправить ситуацию.

Хорошо выспавшись, вы даете своему мозгу перезарядиться, отдохнуть и подготовиться к оптимальной работе на следующий день.

Хороший ночной сон помогает сбросить вес. Недостаток сна влияет на гормоны голода и сытости, два из которых называются грелином и лептином. Грелин сообщает мозгу, что тело жаждет еды и пора поесть.Когда мы не высыпаемся, наши тела производят больше грелина.

Точно так же с лептином этот гормон сообщает мозгу, когда нам достаточно. Однако, когда мы недосыпаем, уровень лептина снижается, не позволяя сильному сигналу попасть в мозг. Полноценный ночной сон помогает поддерживать гормоны в порядке.

способов улучшить ваш метаболизм

В сочетании правильное питание с упражнениями и достаточным количеством сна может помочь вам улучшить метаболизм, что поможет вам сжигать больше калорий.

Согласно исследованиям постельного режима НАСА, «в течение пары дней бездействия метаболизм становится негибким». Ежедневно занимаясь спортом, вы можете ускорить метаболизм и даже улучшить его со временем.

Если у вас медленный метаболизм, на это потребуется время, но его можно улучшить. Наращивание мышц также может помочь вашему телу сжечь немного больше калорий в течение дня, но аэробные упражнения еще больше подтолкнут метаболизм.

Подробнее о физических упражнениях

Если вы хотите узнать больше о науке о похудании, записывайтесь сегодня в Конкордия, Санкт-Петербург. Ученая степень Пола по онлайн-упражнениям. Эта программа на степень научит вас более глубокому пониманию кинезиологии, физиологии упражнений, науки о движениях, фитнеса и благополучия. Вы будете обучаться у знающих преподавателей на курсах, разработанных с учетом вашего успеха, и вы сможете воспользоваться нашим асинхронным полностью онлайн-форматом, что позволит вам сочетать образование с уже занятой жизнью.


Также опубликовано на Medium.

Наука похудания [ИНФОГРАФИЯ]

Поделиться инфографикой

Вставить это изображение на свой сайт

”Просмотрите

Заинтересованы в карьере в сфере фитнеса или оздоровления?

Подготовьтесь к работе в коучинг-центрах, фитнес-центрах и оздоровительных центрах, образовательных учреждениях по вопросам здоровья и благополучия, личном обучении и реабилитационных науках с курсами по кинезиологическим концепциям в человеческих движениях, физических упражнениях и управлении.

Узнать степень

Наука похудания

Есть три основных аспекта похудания: питание, сон и упражнения. Обращая внимание на все три, вы с большей вероятностью увидите результаты.

53% американцев хотели бы похудеть.

Питание

Типичная американская диета превышает рекомендуемые калории из твердых жиров и добавленных сахаров, рафинированного зерна, натрия и насыщенных жиров.

90% американцев едят больше натрия, чем рекомендуется.

Снижение потребления натрия позволит сэкономить до 20 миллиардов долларов в год на медицинских расходах по всей стране.

Эксперты рекомендуют постное мясо, птицу, рыбу, бобы, яйца и орехи, ограничивая при этом трансжиры, натрий и добавленные сахара.

Питьевая вода до и во время еды также может помочь в похудании, а также в поддержании правильного питания.

Диеты, которые можно попробовать для похудания:

  • КЕТО: с низким содержанием углеводов, умеренным содержанием белка и высоким содержанием жира. Предпосылка: человеческое тело создано для более эффективного сжигания жира, а не сахара.
  • ПАЛЕО: с высоким содержанием белка, овощей и семян. Все обработанные продукты, такие как макароны, хлопья или конфеты, не используются. Ешьте, как это делала пещера.
  • ЮЖНЫЙ ПЛЯЖ: с высоким содержанием протеинов и полезных жиров. Низкое содержание некоторых видов углеводов, хотя вам не обязательно полностью исключать их из своего рациона.
  • ВЕГАН: Только продукты и напитки растительного происхождения, исключаются все продукты животного происхождения, включая яйца, мясо и молочные продукты.
  • ДУКАН: с низким содержанием жиров и углеводов. Создан для постоянного изменения образа жизни, который поможет вам достичь своего «истинного веса» и удерживать его на прежнем уровне.

Упражнение

Регулярные упражнения помогут сбросить вес. Было доказано, что упражнения уменьшают стресс, повышают продуктивность и снижают риск сердечных заболеваний, диабета, ожирения и многого другого.

Неактивные взрослые люди теряют от 3 до 8% своей мышечной массы за десятилетие.

Тренировка с отягощениями помогает увеличить силу, тонус и количество имеющихся у вас мышц.

Сон

Взрослые (возраст 26-64) должны спать от семи до девяти часов в сутки. Недостаток сна влияет на гормоны грелин и лептин, которые влияют на чувство голода и энергетический баланс.

Более 1/3 взрослого населения США не высыпается каждую ночь.

Недосыпание увеличивает риск высокого кровяного давления, сердечных заболеваний и инсульта. Хороший сон дает вашему мозгу возможность перезарядиться, отдохнуть и подготовиться к оптимальной работе на следующий день.

Правильная диета с регулярными упражнениями и достаточным количеством сна может улучшить обмен веществ, что поможет вам сжигать больше калорий.

CSP-170 - Технические характеристики - Clavinova - Фортепиано - Музыкальные инструменты - Продукция

рэнд
Размеры Ширина 1412 мм (55 5/8 дюйма) (полированная поверхность: 1418 мм (55-13 / 16 дюймов)) 1412 мм (55 5/8 дюйма) (полированная поверхность: 1418 мм (55-13 / 16 дюймов))
Высота 1040 мм (40-15 / 16 дюймов) (полированная поверхность: 1040 мм (40-15 / 16 дюймов)) 1040 мм (40-15 / 16 дюймов) (полированная поверхность: 1040 мм (40-15 / 16 дюймов))
Глубина 465 мм (18-5 / 16 дюймов) (полированная поверхность: 466 мм (18-6 / 16 дюймов)) 465 мм (18-5 / 16 дюймов) (полированная поверхность: 466 мм (18-6 / 16 дюймов))
Масса Вес 67. 0 кг (147 фунтов, 12 унций) (полированная поверхность: 69,0 кг (152 фунта, 2 унции)) 58,0 кг (127 фунтов, 14 унций) (Полированная поверхность: 61,0 кг (134 фунта, 8 унций))
Клавиатура Количество клавиш 88 88
Тип Клавиатура NWX (Natural Wood X) с поверхностью клавиш из синтетического черного дерева и слоновой кости, спусковой механизм Gh4X (Graded Hammer 3X) Клавиатура из синтетического черного дерева и слоновой кости, спусковой механизм
Чувствительность к силе нажатия Hard2, Hard1, Medium, Soft1, Soft2, Fixed Hard2, Hard1, Medium, Soft1, Soft2, Fixed
Отбойные молотки с 88 ключами
Противовес
Педаль Количество педалей 3 3
Полупедаль Есть Есть
Функции Sustain, Sostenuto, Soft, Glide, Style Start / Stop, Volume и т. Д. Sustain, Sostenuto, Soft, Glide, Style Start / Stop, Volume и т. Д.
Демпферная педаль GP Response
Дисплей Тип в зависимости от смарт-устройства в зависимости от смарт-устройства
Размер в зависимости от смарт-устройства в зависимости от смарт-устройства
Яркость ЖК-дисплея
Сенсорный экран в зависимости от смарт-устройства в зависимости от смарт-устройства
Цвет в зависимости от смарт-устройства в зависимости от смарт-устройства
Функция отображения счета Да * Да *
Функция отображения текста Да * Да *
Функция просмотра текста Да * Да *
Язык 26 языков (английский, японский, немецкий, французский, испанский и т. Д.)) 26 языков (английский, японский, немецкий, французский, испанский и т. Д.)
Панель Язык Английский Английский
Крышка ключа Стиль крышки ключа Раздвижные Раздвижные
Пюпитр Есть Есть
Музыкальные клипы Есть Есть
Генерация тона Звук фортепиано Yamaha CFX, Bösendorfer Imperial Yamaha CFX, Bösendorfer Imperial
Бинауральная выборка Да (только Yamaha CFX Voice) Да (только Yamaha CFX Voice)
Образцы ключей Есть Есть
Плавная разблокировка Есть Есть
Моделирование виртуального резонанса (VRM) Есть Есть
Резонанс струн VRM VRM
Резонанс демпфера VRM VRM
Полифония Количество полифоний (макс. ) 256 256
Предустановка Количество голосов 692 тембра + 29 наборов ударных / спецэффектов 692 тембра + 29 наборов ударных / спецэффектов
Избранные голоса 14 тембров VRM, 113 тембров с супер артикуляцией, 27 естественных! Голоса, 27 Sweet! Голоса, 63 Круто! Голоса, 69 Live! Голоса, 30 органных флейт! Голоса 14 тембров VRM, 113 тембров с супер артикуляцией, 27 естественных! Голоса, 27 Sweet! Голоса, 63 Круто! Голоса, 69 Live! Голоса, 30 органных флейт! Голоса
Совместимость (для воспроизведения песни) XG, GS, GM, GM2 (для воспроизведения песен) XG, GS, GM, GM2
Типы Реверберация 58 Предустановка 58 Предустановка
Припев
Главный компрессор
Главный эквалайзер 5 предустановленных + пользовательских 5 предустановленных + пользовательских
Деталь EQ
Интеллектуальный акустический контроль (IAC) Есть Есть
Стереофонический оптимизатор Есть Есть
Эффект вставки
Эффект вариации
Вокальная гармония VH (44 предустановки) VH (44 предустановки)
Функции Dual / Layers Есть Есть
Разъем Есть Есть
Предустановка Количество предустановленных стилей 470 470
Избранные стили 396 профессиональных стилей, 34 стиля сессий, 4 стиля свободной игры, 36 стилей пианиста 396 профессиональных стилей, 34 стиля сессий, 4 стиля свободной игры, 36 стилей пианиста
Дрочит Область распознавания аккордов заполнена, область распознавания аккордов нижняя Область распознавания аккордов заполнена, область распознавания аккордов нижняя
Управление стилем ВВЕДЕНИЕ x 1, ЗАВЕРШЕНИЕ x 1, ГЛАВНОЕ x 4, ЗАПОЛНЕНИЕ x 4 ВВЕДЕНИЕ x 1, ЗАВЕРШЕНИЕ x 1, ГЛАВНОЕ x 4, ЗАПОЛНЕНИЕ x 4
Другие функции Поиск музыки
Настройка одним нажатием (OTS)
Формат файла
Предустановка Количество предустановленных композиций 403 403
Запись Кол-во композиций 16 16
Объем данных в зависимости от смарт-устройства в зависимости от смарт-устройства
Функция записи Есть Есть
Совместимый формат данных Воспроизведение SMF (формат 0 и 1), XF SMF (формат 0 и 1), XF
Запись SMF (формат 0) SMF (формат 0)
Урок / Руководство Урок / Руководство Правильная тональность, любая клавиша, ваш темп * Правильная тональность, любая клавиша, ваш темп *
Направляющая лампа Stream Lights (4 ступени) Stream Lights (4 ступени)
Фортепианный зал Есть Есть
USB-аудиорекордер Воспроизведение Формат, поддерживаемый интеллектуальным устройством Формат, поддерживаемый интеллектуальным устройством
Запись WAV / AAC WAV / AAC
USB-аудио Растяжка времени Есть Есть
Сдвиг шага Есть Есть
Отмена вокала Подавитель мелодии Подавитель мелодии
Разное Метроном Есть Есть
Диапазон темпа 5 - 500, Tap Tempo 5 - 500, Tap Tempo
Транспонировать -12-0 - +12 -12-0 - +12
Тюнинг 414. 8 - 440,0 - 466,8 Гц 414,8 - 440,0 - 466,8 Гц
Тип весов 9 9
Аудиорекордер / проигрыватель Время записи (макс.) в зависимости от смарт-устройства в зависимости от смарт-устройства
Аудио для оценки Есть Есть
Регистрационная память Есть Есть
Хранилище Внутренняя память в зависимости от смарт-устройства в зависимости от смарт-устройства
Внешние диски в зависимости от смарт-устройства в зависимости от смарт-устройства
Возможности подключения Наушники Стандартный стереофонический штекер (2 шт. ) Стандартный стереофонический штекер (2 шт.)
Микрофон Входная громкость, микрофонный / линейный вход Входная громкость, микрофонный / линейный вход
MIDI ВХОД / ВЫХОД / ПРОХОД ВХОД / ВЫХОД / ПРОХОД
ВХОД ВСПОМ. Стерео мини Стерео мини
ДОПОЛНИТЕЛЬНЫЙ ВЫХОД Л / Л + П, L / L + R, R
Педаль AUX Есть Есть
RGB ВЫХОД
USB К УСТРОЙСТВУ USB К УСТРОЙСТВУ, iPad USB К УСТРОЙСТВУ, iPad
USB К ХОСТУ Есть Есть
Усилители (45 Вт + 45 Вт) × 2 30 Вт × 2
Динамики (16 см + 8 см) × 2 16 см × 2
Акустический оптимизатор Есть Есть
Принадлежности Руководство пользователя, гарантия *, онлайн-регистрация продукта, стенд *, шнур питания, USB-адаптер беспроводной локальной сети *, руководство пользователя USB-адаптера беспроводной локальной сети *, USB-кабель (USB тип A - USB тип B) *, переходной USB-кабель ( USB тип B - USB Micro B / USB тип B - USB тип C) * * Может не входить в комплект поставки в зависимости от вашего региона. Обратитесь к своему дилеру Yamaha. Руководство пользователя, гарантия *, онлайн-регистрация продукта, стенд *, шнур питания, USB-адаптер беспроводной локальной сети *, руководство пользователя USB-адаптера беспроводной локальной сети *, USB-кабель (USB тип A - USB тип B) *, переходной USB-кабель ( USB тип B - USB Micro B / USB тип B - USB тип C) * * Может не входить в комплект поставки в зависимости от вашего региона. Обратитесь к своему дилеру Yamaha.

Платформа облачных сервисов Cisco серии 5000, проспект

Платформа облачных сервисов Cisco (CSP) серии 5000 - это открытая платформа виртуализации сетевых функций (NFV) под ключ, основанная на x86 и виртуальной машине на основе ядра RHEL (KVM).Он оптимизирован для уровня сетевых данных и простоты эксплуатации, им можно управлять с помощью оркестровки или как автономную сетевую платформу.

Обзор продукта

Cisco Cloud Services Platform (CSP) Платформы серии 5000 - это программные и аппаратные платформы виртуальной машины на основе ядра Linux (KVM) x86 для центра обработки данных, регионального концентратора и виртуализации сетевых функций (NFV). Платформы позволяют корпоративным ИТ-командам или поставщикам услуг быстро развертывать любые сетевые виртуальные сервисы Cisco или сторонних производителей с помощью Cisco Network Services Orchestrator (NSO) или любой другой северной системы управления и оркестровки.Или они могут использоваться автономно через простой встроенный собственный веб-интерфейс пользователя, интерфейс командной строки (CLI), API передачи репрезентативного состояния (REST) ​​и интерфейсы NETCONF / YANG. Cisco CSP 5000 Series выпускается в форм-факторах 1 стойка (рис. 1) или 2RU, чтобы соответствовать требованиям виртуальных сетевых функций (VNF) и цепочек сетевых сервисов в сети и вычислениях.

Фигура 1.

Cisco CSP 5200 (1 RU) и CSP 5400 (2RU)

Серия CSP 5000 может быть развернута в центрах обработки данных, региональных концентраторах, центрах совместного размещения, на границе глобальной сети, DMZ и даже в точке присутствия (PoP) поставщика услуг, в которой размещаются различные VNF Cisco и сторонних производителей (см. Рисунок 2). ).

Фигура 2.

Где развернуть CSP серии 5000 в сети

Особенности и преимущества

В таблице 1 представлены основные характеристики и преимущества серии CSP 5000.

Таблица 1. Характеристики и преимущества

Элемент

Пособие

Виртуализация ввода-вывода с одним корнем
(SR-IOV), Open vSwitch Data Plane Development Kit (OVS-DPDK)

Оптимизированная плоскость данных обеспечивает близкие к линии скорости для VNF с поддержкой SR-IOV и обеспечивает высокую пропускную способность с интерфейсами OVS DPDK.

Uniform web, CLI и REST API

CSP 5000 поддерживает NETCONF / YANG, что обеспечивает согласованное поведение на разных интерфейсах.

Интерфейс командной строки

Интерфейс командной строки Cisco IOX сокращает время обучения и обучения.

Отличительная особенность / дифференциатор / возможности

Большинство приложений были виртуализированы за последнее десятилетие, и теперь та же тенденция наблюдается в сетевых службах.Благодаря этой тенденции, часто называемой виртуализацией сетевых функций или NFV, сетевые службы могут развертываться и управляться гораздо более гибко, поскольку они могут быть реализованы в виртуализированной среде с использованием вычислительных ресурсов x86 вместо специально созданных специализированных аппаратных устройств. Серия CSP 5000 может помочь вам в этом технологическом переходе.

В современных центрах обработки данных и центрах размещения сетевых служб сетевые службы в основном работают на специально созданных аппаратных устройствах. Этот подход является негибким, поскольку вы ограничены одной функцией на каждом физическом сетевом устройстве на протяжении всего срока службы, что приводит к недоиспользованию ресурсов.Вам часто приходится ждать недели или даже месяцы для нового оборудования.

Некоторые из сегодняшних проблем для команд центров обработки данных, развертывающих виртуальные сетевые сервисы, включают:

● Идти в ногу с серверной командой. Могут ли группы по работе с сетью, безопасностью и балансировщиком нагрузки развернуть службу виртуальной сети за считанные минуты?

● Коммерческий гипервизор и расходы на поддержку

● Сложность OpenStack, которая все еще слишком сложна для многих организаций

● Накладные расходы OpenStack, для которых требуется от пяти до восьми хостов только для начала

● Ограниченный доступ или отсутствие доступа к серверу VMware vCenter или Microsoft System Center VMM и вычислительным ресурсам

● Отсутствие набора инструментов для управления виртуальными услугами

● Отсутствие опыта работы с ОС Linux

● Низкий уровень комфорта с выделенными аппаратными устройствами

Серия CSP 5000 отвечает этим требованиям с помощью решения, которое обеспечивает гибкость программного обеспечения с производительностью оборудования, что сокращает время и расходы. От границы вашей сети до фермы серверов или точки присутствия вы можете виртуализировать сервисы с помощью CSP 5000, чтобы оптимизировать использование ресурсов, размещая несколько виртуальных сервисов на каждом узле и продлевая жизненный цикл вашего оборудования за счет повторного использования. А более быстрое развертывание новых виртуальных сервисов может помочь вам лучше поддерживать пользователей и приложения.

Некоторые преимущества CSP 5000 включают:

● Простота эксплуатации

● Устройство под ключ, которое можно запустить за пять минут

● Открытая платформа NFV для Cisco и сторонних VNF

● Дружественный к сети синтаксис интерфейса командной строки и интуитивно понятный графический интерфейс

● Повышенная автоматизация и оперативность

Поддержка / совместимость платформы

Серия CSP 5000 поддерживает широкий спектр функций виртуальных сетей (VNF) Cisco и сторонних производителей от сторонних поставщиков, включая межсетевые экраны, балансировщики нагрузки и другие дополнительные услуги. Некоторые поддерживаемые VNF включают:

● Виртуальный маршрутизатор 1000 В Cisco Cloud Services Router (CSR)

● Маршрутизатор Cisco IOS® XRv 9000

● Виртуальное устройство адаптивной безопасности Cisco (ASAv)

● Cisco Firepower ™ NGFW Virtual

● Модуль анализа виртуальной сети Cisco Prime® (vNAM)

● Cisco Virtual Wide Area Application Services (vWAAS)

● Виртуальное устройство Cisco Web Security (WSAv)

● Виртуальный шлюз безопасности Cisco (VSG) для развертываний коммутаторов Cisco Nexus® серии 1000V

● Модуль виртуального супервизора Cisco (VSM) для развертываний коммутаторов Cisco Nexus серии 1000V

● Cisco Data Center Network Manager (DCNM)

Несколько сторонних VNF могут быть запущены на CSP 5000, но для лучшего опыта клиентам следует развернуть VNF, которые сертифицированы как часть сторонней экосистемы VNF Cisco.Для получения информации об экосистеме VNF сторонней компании Cisco и о том, какие VNF сертифицированы и поддерживаются на CSP 5000, посетите:

https://www. cisco.com/c/dam/en/us/solutions/collateral/enterprise-networks/enterprise-network-functions-virtualization-nfv/nfv-open-ecosystem-qualified-vnf-vendors.pdf

Технические характеристики

В таблице 2 приведены технические характеристики продуктов серии CSP 5000.

Таблица 2. Технические характеристики

Товар

Параметры

Шасси

1 1RU на основе стоечного сервера Cisco UCS ® C220 M5

1 2RU на основе стоечного сервера Cisco UCS C240 ​​M5

Процессоры

2x Intel ® Xeon E5-2600 процессоров серий v3 и v4

Память

16 ГБ DDR4-2666 МГц

32 ГБ DDR4-2666 МГц

До 24 слотов DIMM

Сетевые карты

Intel i550 LAN на материнской плате (LOM) (2 x 10G Base T)

Intel i350 PCIe (4 x 1 Gigabit Ethernet)

Двухпортовый адаптер Intel X520 10G SFP +

Четырехпортовый адаптер Intel X710 10G SFP + NIC

Intel XL710 с двумя портами 40G QSFP + сетевая карта

Сеть

PCIe passthrough

Однокорневая виртуализация ввода-вывода (SR-IOV):

● Виртуальный мост Ethernet (VEB)

● Агрегатор портов виртуального Ethernet (VEPA), открытый виртуальный коммутатор (OVS) с DPDK (комплект для разработки плоскости данных)

Каналы портов

Слоты PCIe

Платформа 1RU: до 2x PCI Express (PCIe) 3. 0

Платформа 2RU: до 6 слотов PCI Express (PCIe) 3.0

Жесткие диски

жестких дисков малого форм-фактора или твердотельных накопителей

Жесткие диски малого форм-фактора, доступные спереди

Платформа 1RU: до 8 дисков

Платформа 2RU: до 24 дисков

RAID

12-гигабитный модульный RAID-контроллер Cisco с кэш-памятью 2 ГБ

Модульный 12-гигабитный RAID-контроллер Cisco с кэш-памятью 4 ГБ

Интегрированный контроллер управления Cisco (IMC)

Встроенный контроллер управления основной платой (BMC) IPMI 2.0 для управления и контроля

1x 10/100/1000 Ethernet интерфейс внеполосного управления

Инструмент управления через интерфейс командной строки и веб-интерфейс для автоматизированного управления без отключения света KVM

Управление и операционная деятельность

GUI CLI

REST API

NetConf / Yang

Secure Shell Version 2 (SSHv2) Syslog

Simple Network Management Protocol (SNMP)

Несколько виртуальных последовательных консолей (для поддержки маршрутизатора Cisco IOS XRv 9000 и других VNF) )

Cisco FlexFlash

2 карты Secure Digital (SD) емкостью 64 ГБ

Внутренний USB

Флэш-накопитель USB 16 ГБ

Комплект направляющих

Комплект направляющих шарикоподшипников

Источники питания

Платформа 1RU: Блок питания переменного тока Cisco UCS 770 Вт для стоечного сервера (2)

Платформа 2RU: Блок питания переменного тока Cisco UCS 1050 Вт для стоечного сервера (2)

Типы дисков VNF

IDE и VirtIO

Типы изображений VNF

* . iso

* .ova

* .qcow / qcow2

* .raw

* .vmdk

Контроль доступа

Возможность отключения любых неиспользуемых интерфейсов

Возможность выделить порт управления CSP 2100

Возможность выделить порт управления VNF

Список управления доступом (ACL)

Управление доступом на основе ролей (RBAC)

Аутентификация, авторизация, и бухгалтерский учет (AAA)

● TACACS +

● РАДИУС

Автоматизация

Поддержка файла конфигурации нулевого дня

Возможность сохранения шаблонов услуг

REST API и NetConf / Yang

Интеграция Cisco Network Services Orchestrator (NSO)

Склад

Локальный (жесткие или твердотельные) NFS

● Поддержка загрузки образа VNF из расположения NFS.

● Выделение места на диске NFS для создания виртуальной машины.

Поддержка нескольких дисков (локальных или NFS)

Кластеризация

Объединение ресурсов в число узлов

Масштабирование по запросу

Автоматизация управления ресурсами

Графический интерфейс пользователя поддерживает до 10 узлов

Резервное копирование

Резервное копирование и восстановление текущей конфигурации на уровне устройства (локальное хранилище или хранилище NFS)

Резервное копирование и восстановление данных VNF (локальное хранилище или хранилище NFS)

Информация для заказа

Cisco CSP 5000 доступен для заказа. Возможна поставка, оборудование и программное обеспечение:

Таблица 3. Информация о системе и заказе

PID / SKU

CSP-5216

CSP-5228

CSP-5436

CSP-5444

CSP-5456

Размер стойки

1RU

2RU

Ядра процессора

16

28

36

44

56

Встроенные процессоры

2

Резервное питание

(110/220 В переменного тока)

1540 Вт всего (2x770) включены

2100 Вт (2x1050) включены

Память

12 x 2 DIMM = 24 слота

Сконфигурируйте модули DIMMS на 16 или 32 ГБ в количестве; 4,6,8,10,12,14,16,18,20,22 или 24

● Опции DIMM 16 ГБ; Максимум 384 ГБ

● Опции DIMM 32 ГБ; Максимум Макс 756 ГБ

Слот для диска (малая форма)

10 (полезная 8)

24

Опции диска

1. 2 ТБ (жесткий диск) или 960 ГБ (твердотельный накопитель)

1,2 ТБ (жесткий диск) или 960 ГБ (твердотельный накопитель)

Емкость диска

1,2 * 8/2 = 4,8 ТБ (жесткий диск) или 3,8 ТБ (твердотельный накопитель)

14,4 ТБ (HDD) или 11,5 ТБ (SSD)

Встроенные сетевые карты (LOM)

2x10 GbE

Макс.портов NIC

14 (2x4 + 4 + 2)

30 (6x4 + 4 + 2)

Слоты для сетевых карт PCIe

2 слота

2x10G X520 или 4x10G X710

6 слотов

2x10G X520 или 4x10G X710

Слоты VIC

1

Таблица 4. Опции карты виртуального интерфейса (VIC) и сетевой карты (NIC)

Плата виртуального интерфейса (VIC) 4x10 / 25 GbE SFP28 (VIC 1457)

4x10 / 25 GbE SFP28

Сетевая карта (NIC) 1GbE (i350)

Y (дополнительная надстройка) 4x1GbE RJ45

Сетевая карта (NIC) 2x10GbE SFP + (i520)

Y

Сетевая карта (NIC) 4x10GbE SFP + (i710)

Y

Чтобы разместить заказ, посетите веб-страницу заказа Cisco.Чтобы загрузить программное обеспечение, посетите Центр программного обеспечения Cisco.

Серия CSP 5000 включена в стандартную программу перехода на технологии Cisco (TMP). Обратитесь к руководству и свяжитесь с вашим местным представителем Cisco по работе с клиентами для получения подробной информации о программе.

На серию CSP 5000 распространяется 90-дневная ограниченная гарантия.

Cisco и партнерские услуги

Услуги

от Cisco и наших сертифицированных партнеров могут помочь вам преобразовать работу филиалов и ускорить инновации и рост бизнеса.У нас есть глубина и широта опыта, чтобы создать четкую, воспроизводимую и оптимизированную сеть филиалов с использованием различных технологий. Услуги по планированию и проектированию согласовывают технологии с бизнес-целями и могут повысить точность, скорость и эффективность развертывания. Технические услуги могут помочь вам повысить операционную эффективность, сэкономить деньги и снизить риски. Услуги по оптимизации предназначены для постоянного повышения производительности и помощи вашей команде в использовании новых технологий. Для получения дополнительной информации посетите https: // www. cisco.com/go/services.

Cisco Capital

Гибкие платежные решения, которые помогут вам в достижении ваших целей

Cisco Capital упрощает получение нужной технологии для достижения ваших целей, позволяет трансформировать бизнес и помогает вам оставаться конкурентоспособными. Мы можем помочь вам снизить общую стоимость владения, сохранить капитал и ускорить рост. В более чем 100 странах наши гибкие платежные решения могут помочь вам приобретать оборудование, программное обеспечение, услуги и дополнительное оборудование сторонних производителей с помощью простых и предсказуемых платежей.Учить больше.

Покрытия

CSP | NCSPA

Гофрированная стальная труба (CSP) уже более 100 лет успешно используется в ливневой канализации и водопропускных трубопроводах по всей Северной Америке и во всем мире. За последние 50 лет компания CSP прошла эволюционный процесс, в результате которого были созданы лучшие материалы с более длительным сроком службы в сложных условиях. На этой странице описаны различные покрытия, доступные на CSP для продления срока службы.

CSP с полимерным покрытием

Полимерное покрытие (AASHTO M245, ASTM A742) - это ламинатная пленка, которая наносится на защитные металлические покрытия, обычно оцинкованные.Марка 10/10 (толщина 10 мил, каждая сторона) является основным используемым продуктом. Покрытие Polymer

обеспечивает отличную адгезию к основной стали и повышенную стойкость к коррозии и истиранию. Рекомендации по сроку службы основаны на обширных лабораторных и полевых испытаниях. В то время как CSP с полимерным покрытием использовался не так долго, как гальванизированные или алюминированные покрытия, установки CSP с полимерным покрытием все еще восходят к почти 40-летней давности.

Характеристики полимерного CSP были проверены Corrpro, и было обнаружено, что они практически не ухудшаются, несмотря на установку в некоторых экстремальных условиях.NCSPA и компания Dow Chemical Company, производитель защитной пленки TRENCHCOAT ™, провели лабораторные испытания, чтобы получить дополнительные данные, касающиеся срока службы CSP с полимерным покрытием. Площадки содержали условия окружающей среды с удельным сопротивлением до 100 Ом-см и pH до 2,1.

Недавние испытания показывают, что CSP с полимерным покрытием может выдерживать три уровня абразивного износа. Поскольку полимер является барьерным покрытием, он демонстрирует предсказуемые характеристики долговечности в определенных пределах окружающей среды.Эти критерии и определенные диапазоны для труб с полимерным покрытием показаны на рисунке 3. Трубы с полимерным покрытием, работающие в этих диапазонах, могут достичь 100-летнего срока службы на основе текущих оценок установок в рекомендуемых диапазонах неблагоприятных условий в течение почти 40 лет.

Для получения дополнительной информации о CSP с полимерным покрытием посетите нашу страницу «Исследования и отчеты». Эта страница представляет собой обширный ресурс для различных исследований, связанных с CSP и сроком службы.

Примечание: Условия коррозии в крайних пределах диапазонов окружающей среды могут потребовать корректировки значений срока службы

Оцинкованная (оцинкованная)

Оцинкованная (оцинкованная) сталь (AASHTO M36, ASTM A929) производится с вес покрытия 610 г / м² (2 унции / фут²) поверхности (всего с обеих сторон) для обеспечения толщины цинкового покрытия 43 мкм (0. 0017 дюймов) на каждой поверхности.

Превосходная стойкость цинка к коррозии обусловлена ​​цинкованием, которое обеспечивает барьерное покрытие, а также его катодной защитой или образованием защитных пленок на цинке во время воздействия. Высокая скорость коррозии в сильнокислых и сильнощелочных растворах может быть объяснена отсутствием пленки на поверхности металла (стабильные пленки присутствуют на поверхности при низких скоростях коррозии).

Срок службы оцинкованной стали с цинковым покрытием определяется с использованием диаграммы Американского института железа и стали (AISI) для оценки среднего срока службы оцинкованной стали CSP (см. Ниже).Эта диаграмма предсказывает переменный срок службы в зависимости от pH и удельного сопротивления воды и почвы и является отраслевым стандартом в течение многих лет. Срок службы CSP можно разумно спрогнозировать на основе описанных выше условий окружающей среды. Эта диаграмма основана на оцинкованном CSP 16 калибра с покрытием 610 г / м² (2 унции / фут²) и может применяться для других толщин с соответствующим коэффициентом.

с алюминиевым покрытием типа 2

с алюминиевым покрытием типа 2 (AASHTO M274, ASTM A929) представляет собой покрытие из чистого алюминия (не более 0.35% кремния). Он производится с плотностью покрытия 305 г / м² (1 унция / фут²) поверхности (в сумме с обеих сторон), чтобы обеспечить толщину покрытия 48 мкм (0,0019 дюйма) на каждой поверхности. Тип 2 с алюминиевым покрытием (ALT2) является наиболее широко используемым дополнительным покрытием для CSP. «Алюминий является химически активным металлом, но на нем образуется пассивное покрытие или пленка из оксида алюминия, защищающая его от коррозии во многих средах». Эта пленка довольно устойчива в нейтральных и многих кислотных растворах, но подвержена действию щелочей с pH выше 9.С точки зрения коррозии алюминий имеет преимущество перед оцинкованным при более низком pH и в условиях мягкой воды из-за образования оксидной пленки. Покрытия практически одинаковы при истирании и в воде, где пленка оксида цинка образуется быстро.

CSP с алюминиевым покрытием типа 2 был установлен на тысячах объектов за последние 50 лет, и многие из этих объектов проверялись и продолжают проверяться на предмет производительности. Недавнее исследование AK Steel показало, что 14-ти мерный ALT2 CSP может обеспечить 100-летний срок службы при pH от 5 до 9 и удельном сопротивлении более 1500 Ом-см.

Для получения дополнительной информации о CSP с полимерным покрытием посетите нашу страницу «Исследования и отчеты». Темы исследования варьируются от характеристик алюминизированных стальных труб типа 2 в ливневой канализации до оценки срока службы гофрированных стальных труб.

Дополнительные покрытия

Дополнительный срок службы может быть увеличен за счет увеличения толщины основной стали в соответствии с коэффициентами, указанными в Таблице для оценки среднего срока службы обратного преобразователя, или за счет использования дополнительных систем покрытия.Значения дополнительного срока службы представлены на рисунке 4, озаглавленном «Надстройки срока службы для дополнительных покрытий и покрытий». Эти покрытия обладают преимуществами по сравнению с металлическими покрытиями в виде повышенной стойкости к истиранию, более широкого диапазона условий окружающей среды и более длительного срока службы. Этим покрытиям присуща меньшая изменчивость характеристик, поэтому рекомендуются определенные значения дополнительного срока службы при различных уровнях истирания.

Асфальтовое покрытие (AASHTO M190, ASTM A849)

Асфальтовое покрытие наносится на внутреннюю и внешнюю поверхность трубы с минимальной толщиной 1.3 мм (0,05 дюйма) как с полностью, так и с половинным покрытием. Асфальтовые покрытия обычно используются для защиты со стороны почвы, но также обеспечивают дополнительную защиту со стороны воды. Многочисленные исследования показали, что асфальтовое покрытие обычно обеспечивает дополнительный срок службы внутренней части трубы на 10 лет. Асфальтовые покрытия обеспечивают гораздо более длительный срок службы со стороны почвы и, по сути, расширяют экологические диапазоны для почвенных условий. Согласно Corrpro, «результаты исследования показывают, что добавление асфальтового покрытия могло обеспечить срок службы почвы на стороне почвы более 100 лет.”

Полностью выложен асфальтовым материалом (ASTM A849)

Асфальтовый материал используется для заполнения гофров и обеспечивает минимальную толщину 3,2 мм (1/8 дюйма) над гребнем гофров, обеспечивая гладкую поверхность поверх всю внутреннюю часть трубы. Асфальтовые покрытия обычно используются для улучшения гидравлических характеристик, но также обеспечивают дополнительную защиту от истирания и увеличивают срок службы. Использование асфальтового материала и стали с металлическим покрытием обеспечивает более высокий срок службы.

Перевернутое покрытие с асфальтовым покрытием (AASHTO M190, ASTM A849)

Асфальтовый материал используется для заполнения гофров и обеспечивает минимальную толщину 3,2 мм (1/8 дюйма) над гребнем гофров не менее 25 процент окружности круглой трубы и 40 процентов окружности дуги трубы. Асфальтовое покрытие CSP обеспечивает как дополнительный срок службы, так и дополнительную защиту от истирания на водной стороне трубы. Основываясь на нескольких исследованиях, считается, что покрытие и тротуар обеспечивают дополнительный срок службы 30 лет при большинстве уровней абразивного износа.Это считается очень консервативной оценкой для неабразивных материалов с низким истиранием (уровни 1 и 2).

Инверт, покрытый полимеризованным асфальтовым материалом (ASTM A849)

Асфальт, модифицированный полимером, используется для заполнения гофров и обеспечивает минимальную толщину 1,3 мм (0,05 дюйма) над гребнем гофр для не менее 25 процентов окружность круглой трубы и 40 процентов окружности дуги трубы. Обычно используемый только для инвертированной обработки, полимеризованный асфальт обеспечивает улучшенную адгезию и стойкость к истиранию по сравнению со стандартными асфальтовыми материалами.Полномасштабные испытания на истирание, проведенные Ocean City Research, показывают, что покрытие не ухудшается при умеренном истирании (уровень 3). На основании результатов независимой лаборатории испытаний с использованием метода испытаний ASTM A926, результаты показывают, что имеющееся в продаже полимеризованное асфальтовое покрытие служит по крайней мере в 10 раз дольше, чем стандартное асфальтовое покрытие, и по крайней мере в три раза дольше, чем стандартная водопропускная труба с покрытием и покрытием.

Полимерное покрытие и асфальтовое покрытие

Полимерное покрытие и асфальтовое покрытие обеспечивают отличную адгезию полимерного покрытия к основной стали и последующее сцепление дорожного покрытия с предварительным покрытием.Согласно лабораторным и полевым испытаниям комбинация трех покрытий дает трубу, которая очень устойчива к кислотным стокам. Битумный материал имеет гораздо лучшую адгезию к полимерному покрытию, чем к гальванизированному покрытию.

Полимер с покрытием из полимеризованного асфальта с обратным покрытием

Полномасштабные испытания на истирание, проведенные OCR, показывают, что характеристики полимеризованного асфальта и полимерного покрытия равны по сравнению со стандартным асфальтовым покрытием. Эта система имеет те же характеристики сцепления, что и полимерное покрытие и асфальтовое покрытие.Полевые участки также указывают на улучшенную адгезию.

Инверт, вымощенный бетонным материалом (ASTM A849, ASTM A979)

Слой бетона толщиной 75 мм (3 дюйма) помещается в установленную трубу по крайней мере на 25 процентов окружности круглой трубы и 40 процентов окружности для трубы арки. Бетонные опоры обеспечивают исключительную защиту от истирания и увеличивают срок службы. По словам Стратфулла, «металлическая труба с перевернутой стенкой, вымощенная бетоном, должна обеспечивать неограниченный срок службы, если она имеет достаточную ширину, толщину и качество.По расчетам, можно ожидать, что покрытие толщиной 4 дюйма поверх инвертированной стали приведет к отсрочке его первоначального времени до коррозии примерно в 7,7 раз больше, чем покрытие толщиной 3/4 дюйма ».

Полностью облицованный бетонным материалом (ASTM A849, ASTM A979)

Высокопрочный бетонный материал используется для заполнения гофров и обеспечивает минимальную толщину 3,2 мм (1/8 дюйма) над гребнем гофр, обеспечивая гладкая поверхность по всей внутренней части трубы. Бетонные покрытия обычно используются для улучшения гидравлических характеристик, но также обеспечивают дополнительную защиту от истирания и увеличивают срок службы.Использование высокопрочного бетона и стали с металлическим покрытием обеспечивает высокий срок службы.

Для получения дополнительной информации загрузите наше Руководство по выбору труб здесь.

Рекомбинантный белковый антиген CSP (NBP1-87975PEP): Novus Biologicals

Резюме по антигену рекомбинантного белка CSP

Описание Рекомбинантный белковый антиген с N-концевой меткой His6-ABP, соответствующей ДНК человека JC5.

Источник: E.coli

Аминокислотная последовательность: MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDAT

Источник

E. coli

Тип белка / пептида

Рекомбинантный белковый антиген

Джин

DNAJC5

Чистота

> 80% по данным SDS-PAGE и окрашиванию кумасси синим

Применения / разбавления

Разведения
  • Конкуренция антител 10-100 молярный избыток
Примечания по применению Этот пептид полезен в качестве пептида, блокирующего NBP1-87975.Белок очищали хроматографией на IMAC. Ожидаемая концентрация больше 0,5 мг / мл. Этот продукт производится по запросу, ориентировочная дата доставки - 4 недели после размещения заказа.Для дальнейшей блокировки информации, связанной с пептидами, и протокола щелкните здесь.
Теоретическая МВт

26 кДа.
Примечание об отказе от ответственности: наблюдаемая молекулярная масса белка может отличаться от указанной в списке прогнозируемой молекулярной массы из-за посттрансляционных модификаций, посттрансляционных расщеплений, относительных зарядов и других экспериментальных факторов.

Упаковка, хранение и составы

Хранение

Хранить при -20 ° C. Избегайте циклов замораживания-оттаивания.

Буфер

PBS и 1M мочевина, pH 7,4.

Консервант

Без консерванта

Чистота

> 80% по данным SDS-PAGE и окрашиванию кумасси синим

Банкноты

Этот продукт предназначен для использования в качестве блокирующего антигена для конкурентных анализов антител. Любое другое использование этого антигена связано с риском для пользователя. Использование этого продукта в коммерческих целях строго запрещено. Если у вас возникнут вопросы, обратитесь в службу технической поддержки.

Альтернативные названия для антигена рекомбинантного белка CSP

  • CSP
  • Цистеиновый белок цепочки альфа
  • Цистеиновый белок цепочки
  • DKFZp434N1429
  • DKFZp761N1221
  • Гомолог DnaJ (Hsp40), подсемейство C, член 5
  • член

    0

  • dnaJ 9J00 9000fily5AJ 9J00 C
  • dnaJ Подсемейство C

Ограничения

Этот продукт предназначен только для исследовательского использования и не одобрен для использования на людях или для клинической диагностики.Гарантия на пептиды и белки составляет 3 месяца с даты получения.

Клиенты, которые просматривали этот товар, также просматривали .

..

Виды: Hu, Mu, Rt

Применения: WB, IHC, IHC-P

Виды: Hu, Mu

Применения: WB, ICC / IF, IHC, IHC-P

Породы: Hu

Применения: WB, Flow, ICC / IF, IHC, IHC-P, Flow-IC

Виды: Hu, Mu, Rt

Приложения: WB, Simple Western, Flow, ICC / IF, IHC, IHC-P, IM, IP

Виды: Hu, Mu

Применения: WB, IHC, IP

Виды: Hu, Mu, Rt, Pm, Pm

Применения: WB, Flow, ICC / IF, IHC, CyTOF-ready

Породы: Hu

Применения: WB

Виды: Hu, Mu, Rt

Применения: WB, IHC, IHC-P

Виды: Mu

Применения: WB, IHC, IP, ICC

Виды: Hu, Mu, Rt, Ze

Применения: WB, ICC / IF, IHC, IHC-P

Виды: Hu, Mu

Применения: WB, Simple Western, ChIP, IHC, IHC-P, KD

Виды: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm

Применения: WB, Flow, IB, ICC / IF, IHC, IHC-Fr, IHC-P, IP, B / №

Виды: Hu, Mu

Применения: WB, IHC, IHC-P

Виды: Hu, Mu, Rt

Применения: WB, ICC / IF, IHC, IHC-P, IP

Породы: Hu

Применения: AC

Публикации по белку CSP (NBP1-87975PEP) (0)

Публикаций по белку CSP (NBP1-87975PEP) нет.

Отправляя информацию о публикации, зарабатывайте подарочные карты и скидки для будущих покупок.

Отзывы на протеин CSP (NBP1-87975PEP) (0)

Нет обзоров для CSP Protein (NBP1-87975PEP). Отправив отзыв, вы получите электронную подарочную карту Amazon или скидку на продукцию Novus.
  • Обзор без изображения - 10 долларов / 7 евро / 6 фунтов стерлингов / 10 канадских долларов / 70 юаней / 1110 йен
  • Обзор с изображением - 25 долларов / 18 евро / 15 фунтов стерлингов / 25 канадских долларов / 150 юаней / 2500 йен

Часто задаваемые вопросы по белку CSP (NBP1-87975PEP) (0)

Другие доступные форматы

Дополнительные продукты CSP

Инструмент биоинформатики для белка CSP (NBP1-87975PEP)

Откройте для себя пути, заболевания и гены, связанные с белком CSP (NBP1-87975PEP).

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *

Начните вводить, то что вы ищите выше и нажмите кнопку Enter для поиска. Нажмите кнопку ESC для отмены.

Вернуться наверх